Property Summary

NCBI Gene PubMed Count 91
PubMed Score 352.16
PubTator Score 237.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -2.600 1.4e-07
psoriasis 1.200 2.5e-04
osteosarcoma -2.095 1.8e-08
glioblastoma 1.400 1.7e-05
medulloblastoma, large-cell -1.200 3.2e-05
tuberculosis -1.200 4.5e-05
colon cancer 1.600 5.4e-03
pediatric high grade glioma 1.100 2.1e-06
lung adenocarcinoma 1.488 7.0e-06
invasive ductal carcinoma 1.100 4.8e-02
ovarian cancer 2.300 7.2e-06

Protein-protein Interaction (3)

Gene RIF (66)

PMID Text
26289753 These data suggest that iron uptake induces the production of ROS, which modify DMT1 endocytic cycling, thus changing the iron transport activity at the apical membrane.
26067577 Gene silencing of either CTR1 or DMT1 did not affect copper accumulation in cells, but deficiency in both CTR1 and DMT1 resulted in a complete inhibition of copper uptake.
25817364 the TT genotype and T allele of the 1254T>C polymorphism may be a risk factor for Parkinson disease
25772431 Suggest role for divalent cation transporter DMT1 in the entry of Hg(II) into the intestinal epithelium.
25562168 We propose that DMT1 deficiency negatively affects metabolism and life span of mature erythrocytes; two other aspects of defective erythropoiesis which contribute to the pathophysiology of the disease
24914374 Six months after RYGB surgery, patients exhibit an increase in DMT1 expression in the enterocytes of the tips of the villi at the proximal jejunum
24742347 HIV-1 and the viral protein Tat modulate the expression of solute carrier family 11, member 2 (SLC11A2; proton-coupled divalent metal ion transporter) in immature dendritic
24475238 In Parkinson's disease, increased iron levels are associated with increased Ndfip1 expression for the regulation of DMT1, including abnormal Ndfip1 activation in non-neuronal cell types such as astrocytes.
24448823 DMT1 not only exports iron from endosomes, but also serves to import the metal into the mitochondria
24120082 The DMT1 IVS4 C(+) allele occurred more frequently in WND than in the healthy controls.
23996061 Manganese (Mn) transport carriers DMT1 and FPN1 mediate the apical uptake and basolateral exit of Mn in colonic epithelial Caco-2 cells.
23016933 Identification and characterization of the first SLC11A2 isoform 1a mutation causing a defect in splicing process and an hypomorphic allele expression of the SLC11A2 gene.
22736759 Substrate profile and metal-ion selectivity of human divalent metal-ion transporter-1.
22666436 that 1B/(-)IRE DMT1 expression and intracellular iron influx are early downstream responses to NF-kappaB/RelA activation and acetylation during brain ischemia and contribute to the pathogenesis of stroke-induced neuronal damage
22509377 sequenced exons and exon-intron boundaries of SLC11A2 and TMPRSS6 in all 6 family members with iron-refractory iron deficiency anaemia; cannot exclude or confirm a gene-gene interaction between SLC11A2 and TMPRSS6; gene sequencing did not reveal causative rare mutations
22383495 The data were consistent with PAP7 interacting with DMT1 and regulating DMT1 expression in K562 cells by modulating expression of DMT1 protein.
22371024 These results suggest that the VS4+44C>A polymorphism of the DMT1 gene may interact with place of living and gender to modulate the risk of age-related macular degeneration (AMD).
22310887 DMT1 regulation in an isoform specific fashion can occur by ubiquitination and the events involved have implications for DMT1 function and disease processes.
22154351 analysis of synthesis and biological evaluation of substituted pyrazoles as blockers of divalent metal transporter 1 (DMT1)
22137264 Data suggest that DMT-1 in enterocytes is delocalized from plasma membrane upon iron or zinc depletion; apical abundance of DMT-1 increases with zinc supplementation.
22068728 Data show that both shRNA-DMT1 and shRNA-hCTR1 cells had lower apical Fe uptake, Cu uptake, and Zn content compared to control cells.
21948377 Homology implies that inverted structural symmetry facilitates Slc11 H(+)-driven Me(2+) import and provides a 3D framework to test structure-activity relationships in macrophages and study functional evolution of MntH/Nramp (Slc11) carriers.
21947861 DMT1 is likely involved in endosomal iron transport in placental STB and placental DMT1 + IRE expression was primarily regulated by the IRE/IRP mechanism
21871825 Our data confirm the major role of SLC11A2 in the maintenance of iron homeostasis in humans and demonstrate that the mutation contributes to the development of anemia and hepatic iron overload.
21798283 Variations in the ability of LAT1/DMT1/MTF1/MT1a to process and transport Hg may not play a significant role in the etiology of autism.
21777657 CC haplotype in DMT1 gene is a possible risk factor for Parkinson disease in this Han Chinese population.
21276595 Our findings support an implication for iron metabolism in amyotrophic lateral sclerosis and suggest that the genotype of the SLC11A2 gene could modulate the duration of the disease
21199652 An acute increase in hepcidin concentration reduces intestinal iron absorption through ubiquitin-dependent proteasome degradation of DMT1
21074515 Data show that the peptide can bind to Mn2+ and Co2+ ions by the side chains of the negatively charged residues in the motif and the C-terminal part of DMT1-TMD1.
20945371 DMT1 is a hypoxia-inducible gene.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
20410187 Data suggest that miR-Let-7d participates in the finely tuned regulation of iron metabolism by targeting DMT1-IRE isoform in erythroid cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20164305 Findings demonstrate that the retromer recognizes the recycling signal of DMT1-II and ensures its proper endosomal recycling.
20152801 Ca2+ is a low-affinity noncompetitive inhibitor--but not a transported substrate--of DMT1, explaining in part the effect of high dietary calcium on iron bioavailability.
20007457 Suggest a novel mechanism of regulation of intestinal iron absorption based on inward and outward fluxes at both membrane domains, and repositioning of DMT1 and FPN between membrane and intracellular compartments as a function of iron supply.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19679638 These findings suggest both that DMT1 plays a critical role in ion-mediated neuropathogenesis in Alzheimer's disease (AD) and that pharmacological blockage of DMT1 may provide novel therapeutic strategies against AD.
18667808 DMT1 (NRAMP2/DCT1) genetic variability and resistance to recombinant human erythropoietin therapy in chronic kidney disease patients under haemodialysis.
18419598 Correlation between the expression of DMT1 and the content of hypoxia-inducible factor-1 in hypoxic cells is reported.
18082289 Increased DMT1+IRE expression in MES23.5 cells caused the increased intracellular iron accumulation. This resulted in the increased oxidative stress leading to ultimate cell apoptosis.
17980698 These results demonstrate the importance of these regions in coupling of metal ions and protons as well as the possible proximity of I144 and F227 in the folded structure of DCT1.
17510944 two DMT1 intronic SNPs showed positive association with restless legs syndrome in patients with a history of anemia, when compared to RLS patients without anemia.
17293870 Modulation of DMT-1 function by L-type calcium channel blockers is a pharmacological therapy for the treatment of iron overload disorders.
17109629 Specific signals or cues to direct DMT1 to the appropriate subcellular compartments (e.g. in erythroid cells) or the plasma membrane (e.g. in intestine).
16439678 DMT1 mutations are responsible for severe hypochromic microcytic anemia in humans.
16123094 DMT1 isoforms are expressed in first trimester human placenta and embryonic tissues
15880641 Transferrin receptor (TfR) and hemochromatosis factor, as well as TfR and DMT1 interact in placental trophoblast cells
15792797 Intracellular localization of SLC11A2 to endosomal/lysosomal compartment is regulated by iron.
15644277 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15636493 Observational study of gene-disease association. (HuGE Navigator)
15459009 Mutation of DMT1 identified in a female with severe hypochromic microcytic anemia and iron overload.
15223008 Observational study of gene-disease association. (HuGE Navigator)
15139022 comparison of the regional distribution of SFT/UbcH5A and DMT1 mRNA in the adult brain
15024413 the G185R mutant DMT1 exhibits a new, constitutive Ca(2+) permeability
14768003 Increased expression of DMT1 may play an important role in the pathogenesis of cirrhosis-associated hepatic iron overload.
12973678 divalent metal ion transporter-1 may be of pivotal importance for the regulation of metal ion homeostasis within organs involved in absorption and excretion of ions
12949888 in iron deficiency DMT-1 and mobilferrin concentrated in apical surface of duodenal villae; increase due to increased binding to mucin in vesicles near surfacel; localized in goblet cells and outside cell in luminal mucin
12734107 These results demonstrate that DMT1 is a physiologically relevant Cu(1+) transporter in intestinal cells, indicating that intestinal absorption of copper and iron are intertwined.
12662899 Using the Xenopus oocyte expression system, human Nramp2, a human intestinal iron transporter, was shown to work as a cadmium transporter
12209011 iron regulation of DMT1 involves the expression of a previously unrecognized upstream 5' exon (exon 1A) of the human and murine DMT1 gene
12127992 DMT1 is a transporter for lead
11943663 airway epithelial cells increase mRNA and expression of the Nramp2/DMT1/DCT1 without an IRE after exposure to iron. The increase results in an elevated transport of iron and its probable detoxification by these cells.
11897618 expression levels of human DCT1 mRNA, and to a lesser extent IREG1 mRNA, are regulated in an iron-dependent manner
11891802 location was observed on or near the cell surface suggesting it might participate in surface membrane transport of iron

AA Sequence

MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKL      1 - 70
WAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKLLWILLLATLVGLLLQRLAARLGVVTGLHLAEVCHRQ     71 - 140
YPKVPRVILWLMVELAIIGSDMQEVIGSAIAINLLSVGRIPLWGGVLITIADTFVFLFLDKYGLRKLEAF    141 - 210
FGFLITIMALTFGYEYVTVKPSQSQVLKGMFVPSCSGCRTPQIEQAVGIVGAVIMPHNMYLHSALVKSRQ    211 - 280
VNRNNKQEVREANKYFFIESCIALFVSFIINVFVVSVFAEAFFGKTNEQVVEVCTNTSSPHAGLFPKDNS    281 - 350
TLAVDIYKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVMEGFLNLKWSRFARVVLTRSIAI    351 - 420
IPTLLVAVFQDVEHLTGMNDFLNVLQSLQLPFALIPILTFTSLRPVMSDFANGLGWRIAGGILVLIICSI    421 - 490
NMYFVVVYVRDLGHVALYVVAAVVSVAYLGFVFYLGWQCLIALGMSFLDCGHTCHLGLTAQPELYLLNTM    491 - 560
DADSLVSR                                                                  561 - 568
//

Text Mined References (95)

PMID Year Title
26289753 2015 Iron-induced reactive oxygen species mediate transporter DMT1 endocytosis and iron uptake in intestinal epithelial cells.
26067577 2015 Copper uptake by DMT1: a compensatory mechanism for CTR1 deficiency in human umbilical vein endothelial cells.
25817364 2015 Is the 1254T>C polymorphism in the DMT1 gene associated with Parkinson's disease?
25772431 2015 Participation of divalent cation transporter DMT1 in the uptake of inorganic mercury.
25562168 2014 DMT1-mutant erythrocytes have shortened life span, accelerated glycolysis and increased oxidative stress.
25491917 2015 Inhibition of iron uptake by ferristatin II is exerted through internalization of DMT1 at the plasma membrane.
25326704 2014 Crystal structure of a SLC11 (NRAMP) transporter reveals the basis for transition-metal ion transport.
24914374 2014 Changes in iron transporter divalent metal transporter 1 in proximal jejunum after gastric bypass.
24475238 2014 Increased Ndfip1 in the substantia nigra of Parkinsonian brains is associated with elevated iron levels.
24448823 2014 Evidence for mitochondrial localization of divalent metal transporter 1 (DMT1).
24120082 2014 Polymorphisms of metal transporter genes DMT1 and ATP7A in Wilson's disease.
23996061 2013 Kinetics of manganese transport and gene expressions of manganese transport carriers in Caco-2 cell monolayers.
23016933 2012 Identification and characterization of the first SLC11A2 isoform 1a mutation causing a defect in splicing process and an hypomorphic allele expression of the SLC11A2 gene.
22736759 2012 Substrate profile and metal-ion selectivity of human divalent metal-ion transporter-1.
22666436 2012 1B/(-)IRE DMT1 expression during brain ischemia contributes to cell death mediated by NF-?B/RelA acetylation at Lys310.
22509377 2012 Candidate gene sequencing of SLC11A2 and TMPRSS6 in a family with severe anaemia: common SNPs, rare haplotypes, no causative mutation.
22383495 2012 DMT1 (IRE) expression in intestinal and erythroid cells is regulated by peripheral benzodiazepine receptor-associated protein 7.
22371024 2012 An association between environmental factors and the IVS4+44C>A polymorphism of the DMT1 gene in age-related macular degeneration.
22310887 2012 Isoform specific regulation of divalent metal (ion) transporter (DMT1) by proteasomal degradation.
22154351 2012 Synthesis and biological evaluation of substituted pyrazoles as blockers of divalent metal transporter 1 (DMT1).
22137264 2012 Coordinate expression and localization of iron and zinc transporters explain iron-zinc interactions during uptake in Caco-2 cells: implications for iron uptake at the enterocyte.
22068728 2012 Iron, copper, and zinc transport: inhibition of divalent metal transporter 1 (DMT1) and human copper transporter 1 (hCTR1) by shRNA.
21948377 2012 Nutritional immunity: homology modeling of Nramp metal import.
21947861 2012 Divalent metal transporter 1 expression and regulation in human placenta.
21871825 2011 A novel N491S mutation in the human SLC11A2 gene impairs protein trafficking and in association with the G212V mutation leads to microcytic anemia and liver iron overload.
21798283 2011 Lack of association between autism and four heavy metal regulatory genes.
21777657 2011 DMT1 polymorphism and risk of Parkinson's disease.
21276595 2011 Association between divalent metal transport 1 encoding gene (SLC11A2) and disease duration in amyotrophic lateral sclerosis.
21199652 2011 Intestinal DMT1 cotransporter is down-regulated by hepcidin via proteasome internalization and degradation.
21074515 2011 Structure and metal ion binding of the first transmembrane domain of DMT1.
20945371 2011 Divalent metal transporter 1 is a hypoxia-inducible gene.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20410187 2010 Regulation of divalent metal transporter 1 (DMT1) non-IRE isoform by the microRNA Let-7d in erythroid cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20164305 2010 Retromer-mediated direct sorting is required for proper endosomal recycling of the mammalian iron transporter DMT1.
20152801 2010 Interaction of calcium with the human divalent metal-ion transporter-1.
20007457 2010 Iron supply determines apical/basolateral membrane distribution of intestinal iron transporters DMT1 and ferroportin 1.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19706893 2009 Divalent metal transporter 1 (DMT1) regulation by Ndfip1 prevents metal toxicity in human neurons.
19679638 2009 Divalent metal transporter 1 is involved in amyloid precursor protein processing and Abeta generation.
18876082 1948 [Not Available].
18776082 2008 Regulation of the divalent metal ion transporter DMT1 and iron homeostasis by a ubiquitin-dependent mechanism involving Ndfips and WWP2.
18667808 2008 DMT1 (NRAMP2/DCT1) genetic variability and resistance to recombinant human erythropoietin therapy in chronic kidney disease patients under haemodialysis.
18419598 2008 Correlation between the expression of divalent metal transporter 1 and the content of hypoxia-inducible factor-1 in hypoxic HepG2 cells.
18082289 2008 Over-expressed human divalent metal transporter 1 is involved in iron accumulation in MES23.5 cells.
17980698 2008 Site-directed mutagenesis investigation of coupling properties of metal ion transport by DCT1.
17932044 2007 Evolution of differences in transport function in Slc11a family members.
17897319 2007 Integral and associated lysosomal membrane proteins.
17510944 2007 Molecular genetic studies of DMT1 on 12q in French-Canadian restless legs syndrome patients and families.
17293870 2007 Ca2+ channel blockers reverse iron overload by a new mechanism via divalent metal transporter-1.
17109629 2007 Functional properties of multiple isoforms of human divalent metal-ion transporter 1 (DMT1).
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16541075 2006 The finished DNA sequence of human chromosome 12.
16439678 2006 Two new human DMT1 gene mutations in a patient with microcytic anemia, low ferritinemia, and liver iron overload.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16160008 2006 Microcytic anemia and hepatic iron overload in a child with compound heterozygous mutations in DMT1 (SCL11A2).
16123094 2005 Expression of divalent metal transporter 1 (DMT1) isoforms in first trimester human placenta and embryonic tissues.
15880641 2005 Transferrin receptor co-localizes and interacts with the hemochromatosis factor (HFE) and the divalent metal transporter-1 (DMT1) in trophoblast cells.
15792797 2005 Regulation of divalent metal transporter expression in human intestinal epithelial cells following exposure to non-haem iron.
15644277 2005 Candidate gene association study of solute carrier family 11a members 1 (SLC11A1) and 2 (SLC11A2) genes in Alzheimer's disease.
15636493 2004 SLC11A1 (NRAMP1) but not SLC11A2 (NRAMP2) polymorphisms are associated with susceptibility to tuberculosis in a high-incidence community in South Africa.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459009 2005 Identification of a human mutation of DMT1 in a patient with microcytic anemia and iron overload.
15223008 DMT1 genetic variability is not responsible for phenotype variability in hereditary hemochromatosis.
15139022 2004 Developmental, regional, and cellular expression of SFT/UbcH5A and DMT1 mRNA in brain.
15024413 2004 A spontaneous, recurrent mutation in divalent metal transporter-1 exposes a calcium entry pathway.
14768003 2004 Increased duodenal expression of divalent metal transporter 1 and iron-regulated gene 1 in cirrhosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12973678 2003 Distribution of DMT 1 within the human glandular system.
12949888 2003 Localization of the iron transport proteins Mobilferrin and DMT-1 in the duodenum: the surprising role of mucin.
12949720 2003 Duodenal cytochrome b and hephaestin expression in patients with iron deficiency and hemochromatosis.
12734107 2003 DMT1, a physiologically relevant apical Cu1+ transporter of intestinal cells.
12662899 2003 Cadmium transport by human Nramp 2 expressed in Xenopus laevis oocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475959 2002 Alternative splicing regulates the subcellular localization of divalent metal transporter 1 isoforms.
12209011 2002 Previously uncharacterized isoforms of divalent metal transporter (DMT)-1: implications for regulation and cellular function.
12139757 2002 Erythroid 5-aminolevulinate synthase, ferrochelatase and DMT1 expression in erythroid progenitors: differential pathways for erythropoietin and iron-dependent regulation.
12127992 2002 Uptake of lead and iron by divalent metal transporter 1 in yeast and mammalian cells.
11897618 2002 Intestinal expression of genes involved in iron absorption in humans.
11891802 2002 Cellular location of proteins related to iron absorption and transport.
11842004 2002 The ferrireductase paraferritin contains divalent metal transporter as well as mobilferrin.
11755534 2002 Rapid regulation of divalent metal transporter (DMT1) protein but not mRNA expression by non-haem iron in human intestinal Caco-2 cells.
11439223 2001 DMT1 gene expression and cadmium absorption in human absorptive enterocytes.
11095929 2000 Identification and localization of divalent metal transporter-1 (DMT-1) in term human placenta.
10984552 2000 Localization of iron transport and regulatory proteins in human cells.
10751401 2000 Human NRAMP2/DMT1, which mediates iron transport across endosomal membranes, is localized to late endosomes and lysosomes in HEp-2 cells.
10625641 2000 Nramp2 expression is associated with pH-dependent iron uptake across the apical membrane of human intestinal Caco-2 cells.
9990067 1999 Association of HFE protein with transferrin receptor in crypt enterocytes of human duodenum.
9790986 1998 Human natural resistance-associated macrophage protein 2: gene cloning and protein identification.
9642100 1998 The human Nramp2 gene: characterization of the gene structure, alternative splicing, promoter region and polymorphisms.
9464519 Complete nucleotide sequence of human NRAMP2 cDNA.
9241278 1997 Microcytic anaemia mice have a mutation in Nramp2, a candidate iron transporter gene.
7613023 1995 Cloning and characterization of a second human NRAMP gene on chromosome 12q13.