Property Summary

NCBI Gene PubMed Count 43
PubMed Score 128.03
PubTator Score 78.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.114 7.5e-03
psoriasis 1.300 1.3e-04
juvenile dermatomyositis 1.008 1.0e-09
lung cancer 1.600 1.9e-02
colon cancer 1.700 8.2e-05
ovarian cancer 1.500 4.9e-03

 GWAS Trait (1)

Protein-protein Interaction (9)

Gene RIF (23)

PMID Text
25266719 arsenic, a carcinogenic metal, decreases cellular levels of SLBP by inducing its proteasomal degradation and inhibiting SLBP transcription via epigenetic mechanisms
25002523 Although the C-terminal tail of dSLBP does not contact the RNA, phosphorylation of the tail promotes SLBP conformations competent for RNA binding and thereby appears to reduce the entropic penalty for the association.
24255165 C-terminal extension of Lsm4 interacts directly with the histone mRNP, contacting both SLBP and 3'hExo.
24122909 the S/G2 stable mutant form of SLBP is degraded by proteasome in G1, indicating that indicating that the SLBP degradation in G1 is independent of the previously identified SLBP degradation at S/G2
23941746 Alternative splicing allows the synthesis of HBP/SLBP isoforms with different properties that may be important for regulating HBP/SLBP functions during replication stress.
23329046 the crystal structure of a ternary complex of human SLBP RNA binding domain, human 3'hExo, and a 26-nucleotide stem-loop RNA is reported.
23286197 Data suggest that oligomerization and SLBP phosphorylation regulate SLBP-SLIP1-histone-mRNA complex formation/disassociation; sequential and ordered assembly is required.
23286197 This paper describes the biophysical characterization of human SLBP and the SLBP-SLIP1 complex. Human SLBP is an intrinsically disordered protein that is phosphorylated at 23 Ser/Thr sites when expressed in a eukaryotic expression system such as baculovirus. Unphosphorylated human SLBP forms a high affinity heterotetramer with SLIP1 and the SLBP-SLIP1 complex is regulated by SLBP phosphorylation.
23234701 Using yeast two-hybrid screening, the authors identify CT initiation factor-interacting protein (CTIF) as a protein that binds directly to SLBP. SLBP preferentially associates with the CT complex of histone mRNAs consisting of CBP80/CBP20, but not with the eIF4E/eIF4G (ET) complex, as has been proposed. Rapid degradation of histone mRNA on the inhibition of DNA replication requires association of SLBP with CTIF.
22907757 This paper shows that SLBP is a substrate for the prolyl isomerase Pin1. Pin1, along with PP2A, facilitates dissociation of the SLBP-histone mRNA complex at the end of S-phase, thereby promoting histone mRNA decay and SLBP ubiquitination.
22439849 The nuclear magnetic resonance and kinetic studies presented here provide a framework for understanding how SLBP recognizes histone mRNA and highlight possible structural roles of phosphorylation and proline isomerization in RNA binding proteins
22328085 haploinsufficiency of SLBP and/or WHSC2 (NELF-A) contributes to several novel cellular phenotypes of WHS.
19155325 These results suggest a previously undescribed role for SLBP in histone mRNA export.
18490441 Study concludes that the increase in cyclin A/Cdk1 activity at the end of S phase triggers degradation of SLBP at S/G(2).
18025107 identified five conserved residues in a 15-amino-acid region in the amino-terminal portion of SLBP, each of which is required for translation.
17499042 Here we show that NELF interacts with the cap binding complex (CBC), a factor that plays important roles in mRNA processing steps, and the two factors together participate in the 3' end processing of histone mRNAs, through association with the SLBP.
16982637 SLBP is required for efficient histone 3'-UTR end processing.
16931877 replication-dependent histone mRNAs are likely to be the sole target of SLBP
16492733 Removal of the phosphoryl group from T230 by either dephosphorylation or mutation results in a 7-fold reduction in the affinity of SLBP for the stem-loop RNA
15916543 SLBP is required for efficient DNA replication probably because a decreased ability to assemble chromatin results in a decrease in the rate of DNA replication
15829567 SLBP is imported into the cell nucleus during the cell cycle.
15546920 human HBP/SLBP is essential for the coordinate synthesis of DNA and histone proteins and is required for progression through the cell division cycle
12588979 SLBP is the only cell cycle-regulated factor required for histone pre-mRNA processing

AA Sequence

MACRPRSPPRHQSRCDGDASPPSPARWSLGRKRRADGRRWRPEDAEEAEHRGAERRPESFTTPEGPKPRS      1 - 70
RCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQK     71 - 140
QINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEI    141 - 210
HPVDLESAESSSEPQTSSQDDFDVYSGTPTKVRHMDSQVEDEFDLEACLTEPLRDFSAMS              211 - 270
//

Text Mined References (50)

PMID Year Title
25893362 2015 A Potential New Mechanism of Arsenic Carcinogenesis: Depletion of Stem-Loop Binding Protein and Increase in Polyadenylated Canonical Histone H3.1 mRNA.
25266719 2014 Arsenic induces polyadenylation of canonical histone mRNA by down-regulating stem-loop-binding protein gene expression.
25002523 2014 Molecular mechanisms for the regulation of histone mRNA stem-loop-binding protein by phosphorylation.
24255165 2014 The C-terminal extension of Lsm4 interacts directly with the 3' end of the histone mRNP and is required for efficient histone mRNA degradation.
24122909 2014 Translation regulation and proteasome mediated degradation cooperate to keep stem-loop binding protein low in G1-phase.
23941746 2013 Replication stress-induced alternative mRNA splicing alters properties of the histone RNA-binding protein HBP/SLBP: a key factor in the control of histone gene expression.
23329046 2013 Structure of histone mRNA stem-loop, human stem-loop binding protein, and 3'hExo ternary complex.
23286197 2013 Assembly of the SLIP1-SLBP complex on histone mRNA requires heterodimerization and sequential binding of SLBP followed by SLIP1.
23234701 2013 Rapid degradation of replication-dependent histone mRNAs largely occurs on mRNAs bound by nuclear cap-binding proteins 80 and 20.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22907757 2012 The prolyl isomerase Pin1 targets stem-loop binding protein (SLBP) to dissociate the SLBP-histone mRNA complex linking histone mRNA decay with SLBP ubiquitination.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22439849 2012 Interaction of the histone mRNA hairpin with stem-loop binding protein (SLBP) and regulation of the SLBP-RNA complex by phosphorylation and proline isomerization.
22328085 2012 Characterizing the functional consequences of haploinsufficiency of NELF-A (WHSC2) and SLBP identifies novel cellular phenotypes in Wolf-Hirschhorn syndrome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20348956 2010 A sequence variant at 4p16.3 confers susceptibility to urinary bladder cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19155325 2009 Knockdown of SLBP results in nuclear retention of histone mRNA.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18490441 2008 Phosphorylation of threonine 61 by cyclin a/Cdk1 triggers degradation of stem-loop binding protein at the end of S phase.
18172165 2008 Degradation of histone mRNA requires oligouridylation followed by decapping and simultaneous degradation of the mRNA both 5' to 3' and 3' to 5'.
18025107 2008 SLIP1, a factor required for activation of histone mRNA translation by the stem-loop binding protein.
17499042 2007 NELF interacts with CBC and participates in 3' end processing of replication-dependent histone mRNAs.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16982637 2006 Binding of human SLBP on the 3'-UTR of histone precursor H4-12 mRNA induces structural rearrangements that enable U7 snRNA anchoring.
16931877 2006 Genome-wide analysis of mRNAs bound to the histone stem-loop binding protein.
16912046 2006 Characterization of 3'hExo, a 3' exonuclease specifically interacting with the 3' end of histone mRNA.
16492733 2006 Combined top-down and bottom-up proteomics identifies a phosphorylation site in stem-loop-binding proteins that contributes to high-affinity RNA binding.
16086026 2005 Regulated degradation of replication-dependent histone mRNAs requires both ATR and Upf1.
15916543 2005 Expression of an RNAi-resistant SLBP restores proper S-phase progression.
15829567 2005 Nuclear import of the stem-loop binding protein and localization during the cell cycle.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15546920 2004 The human histone gene expression regulator HBP/SLBP is required for histone and DNA synthesis, cell cycle progression and cell proliferation in mitotic cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15260483 2004 Electrostatic contribution of serine phosphorylation to the Drosophila SLBP--histone mRNA complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12588979 2003 Phosphorylation of stem-loop binding protein (SLBP) on two threonines triggers degradation of SLBP, the sole cell cycle-regulated factor required for regulation of histone mRNA processing, at the end of S phase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12415002 2002 Stem-loop binding protein accumulates during oocyte maturation and is not cell-cycle-regulated in the early mouse embryo.
11782445 2002 A novel zinc finger protein is associated with U7 snRNP and interacts with the stem-loop binding protein in the histone pre-mRNP to stimulate 3'-end processing.
10982817 2000 A deubiquitinating enzyme UBPY interacts with the Src homology 3 domain of Hrs-binding protein via a novel binding motif PX(V/I)(D/N)RXXKP.
10825184 2000 Stem-loop binding protein, the protein that binds the 3' end of histone mRNA, is cell cycle regulated by both translational and posttranslational mechanisms.
10207079 1999 Stem-loop binding protein facilitates 3'-end formation by stabilizing U7 snRNP binding to histone pre-mRNA.
9049306 1997 The gene for histone RNA hairpin binding protein is located on human chromosome 4 and encodes a novel type of RNA binding protein.
8957003 1996 The protein that binds the 3' end of histone mRNA: a novel RNA-binding protein required for histone pre-mRNA processing.
8652556 1996 Efficient extraction and partial purification of the polyribosome-associated stem-loop binding protein bound to the 3' end of histone mRNA.
1338771 1992 Expressed genes, Alu repeats and polymorphisms in cosmids sequenced from chromosome 4p16.3.