Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.41
PubTator Score 4.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
gastric cancer 1.100 1.6e-03
cutaneous lupus erythematosus 1.800 1.7e-03
osteosarcoma -2.348 2.2e-03
glioblastoma 1.200 2.6e-02
Atopic dermatitis 1.200 2.9e-02
tuberculosis 1.500 3.8e-03
lung cancer -1.300 4.4e-02
breast carcinoma 1.200 1.5e-03
interstitial cystitis 2.600 2.3e-03
pediatric high grade glioma 1.200 9.2e-03
posterior fossa group A ependymoma 1.100 3.9e-03
primary Sjogren syndrome 1.300 2.5e-03
invasive ductal carcinoma 2.400 6.2e-04
psoriasis 1.300 4.8e-07
inflammatory breast cancer 1.800 3.3e-02
lung carcinoma -1.400 3.4e-09
ductal carcinoma in situ 1.800 8.6e-03
ulcerative colitis 2.100 7.0e-07
ovarian cancer 2.000 3.5e-03
head and neck cancer and chronic obstruc... 1.800 6.1e-03

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVMRPLWSLLLWEALLPITVTGAQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLET      1 - 70
LYHSRFLGRAQLHSNLSLELGPLESGDSGNFSVLMVDTRGQPWTQTLQLKVYDAVPRPVVQVFIAVERDA     71 - 140
QPSKTCQVFLSCWAPNISEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWD    141 - 210
LATVTPWDSCHHEAAPGKASYKDVLLVVVPVSLLLMLVTLFSAWHWCPCSGKKKKDVHADRVGPETENPL    211 - 280
VQDLP                                                                     281 - 285
//

Text Mined References (10)

PMID Year Title
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12928397 2003 Functional requirements for interactions between CD84 and Src homology 2 domain-containing proteins and their contribution to human T cell activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11313408 2001 Cloning, expression, and function of BLAME, a novel member of the CD2 family.