Property Summary

NCBI Gene PubMed Count 32
PubMed Score 47.55
PubTator Score 469.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
cutaneous lupus erythematosus 3.300 4.7e-04
osteosarcoma -4.397 1.2e-05
periodontitis 1.900 1.4e-24
tuberculosis and treatment for 6 months -1.700 1.0e-02
lung cancer -5.300 3.8e-06
sarcoidosis 2.400 3.4e-02
Breast cancer -3.000 2.7e-02
interstitial cystitis 3.000 4.2e-04
lung adenocarcinoma 1.300 2.1e-07
group 3 medulloblastoma -1.200 2.7e-02
primary Sjogren syndrome 2.100 3.4e-03
psoriasis 1.800 1.4e-14
invasive ductal carcinoma 1.151 2.2e-02
lung carcinoma -1.500 3.8e-09
non-small cell lung carcinoma 1.200 1.3e-10
mucosa-associated lymphoid tissue lympho... 2.068 3.2e-02
ulcerative colitis 3.300 1.2e-06
chronic rhinosinusitis 1.047 4.5e-02
Chronic obstructive pulmonary disease -1.100 1.6e-02

Gene RIF (16)

PMID Text
26310579 Blimp-1 regulates the transcription of CS1 gene in NK and B cell lines from multiple myeloma and diffuse large B cell lymphoma patients.
25312647 SLAMF7-triggered inhibition is mediated by a mechanism involving Src kinases, CD45, and SHIP-1 that is defective in MM cells
24299175 Our data highlight the therapeutic potential of targeting CD319 in rheumatoid arthritis
23956418 These results suggest a role for CD319 and CD229 in the systemic lupus erythematosus disease process.
23695528 SLAMF7 plays an inhibitory role in human monocytes to control proinflammatory immune responses.
23250953 These data suggest an involvement of CRACC-mediated NK cell activation in periodontal tissue destruction and point to a plausible distinction in the pathobiology of aggressive and chronic periodontitis.
20345977 altered expression of splice variants of CS1 and 2B4 that mediate differential signalling in PBMC from patients with SLE.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19904767 Data show that pair-wise ligations of 2B4 with DNAM-1 and/or NKG2D lead to increased effector functions of primary CD4(+)CD28(-) T cells to suboptimal levels of anti-CD3 stimulation.
18451245 HuLuc63 eliminates myeloma cells, at least in part, via NK-mediated ADCC and shows the therapeutic potential of targeting CS1 with HuLuc63 for the treatment of multiple myeloma.
18216865 Observational study of gene-disease association. (HuGE Navigator)
17981603 2B4, NTB-A and CRACC have roles in the regulation of Natural Killer cell function [review]
17906076 CS1 was expressed at adhesion-promoting uropod membranes of polarized Multiple Myeloma cells, andis required for MM cell adhesion to bone marrow stromal cells
17878365 CS1 may play a role in the regulation of B lymphocyte proliferation during immune responses
16410313 blocking the engagement of 2B4, NTB-A and CRACC has no effect on the proliferation or development of the cytotoxic potential of NK cells but triggering by their physiological ligands on MHC class I-negative target cells induces potent NK cell cytotoxicity
15368295 CS1-L and CS1-S may differentially regulate human NK cell functions

AA Sequence

MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTI      1 - 70
IVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSN     71 - 140
KNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPIL    141 - 210
ARKLCEGAADDPDSSMVLLCLLLVPLLLSLFVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGE    211 - 280
NTEYDTIPHTNRTILKEDPANTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI                   281 - 335
//

Text Mined References (35)

PMID Year Title
26310579 2016 Blimp-1/PRDM1 regulates the transcription of human CS1 (SLAMF7) gene in NK and B cells.
25312647 2015 Immune cell inhibition by SLAMF7 is mediated by a mechanism requiring src kinases, CD45, and SHIP-1 that is defective in multiple myeloma cells.
24299175 2013 PDL241, a novel humanized monoclonal antibody, reveals CD319 as a therapeutic target for rheumatoid arthritis.
23956418 2013 Systemic lupus erythematosus immune complexes increase the expression of SLAM family members CD319 (CRACC) and CD229 (LY-9) on plasmacytoid dendritic cells and CD319 on CD56(dim) NK cells.
23695528 2013 CS1 (SLAMF7) inhibits production of proinflammatory cytokines by activated monocytes.
23250953 2013 Role of the NK cell-activating receptor CRACC in periodontitis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
20345977 2010 Altered expression of signalling lymphocyte activation molecule (SLAM) family receptors CS1 (CD319) and 2B4 (CD244) in patients with systemic lupus erythematosus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19904767 2010 Activating NK-cell receptors co-stimulate CD4(+)CD28(-) T cells in patients with rheumatoid arthritis.
18451245 2008 CS1, a potential new therapeutic antibody target for the treatment of multiple myeloma.
18216865 2008 Association of LY9 in UK and Canadian SLE families.
17981603 2008 Regulation of NK cell activity by 2B4, NTB-A and CRACC.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17906076 2008 Anti-CS1 humanized monoclonal antibody HuLuc63 inhibits myeloma cell adhesion and induces antibody-dependent cellular cytotoxicity in the bone marrow milieu.
17878365 2007 CS1 (CRACC, CD319) induces proliferation and autocrine cytokine expression on human B lymphocytes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16410313 2006 2B4 (CD244), NTB-A and CRACC (CS1) stimulate cytotoxicity but no proliferation in human NK cells.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16339536 2005 The cytotoxicity receptor CRACC (CS-1) recruits EAT-2 and activates the PI3K and phospholipase Cgamma signaling pathways in human NK cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15368295 2004 Molecular and functional characterization of a CS1 (CRACC) splice variant expressed in human NK cells that does not contain immunoreceptor tyrosine-based switch motifs.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12621057 2003 The cell surface expression of SAP-binding receptor CD229 is regulated via its interaction with clathrin-associated adaptor complex 2 (AP-2).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12242590 2002 Mouse novel Ly9: a new member of the expanding CD150 (SLAM) family of leukocyte cell-surface receptors.
11802771 2002 A novel immunoglobulin superfamily receptor (19A) related to CD2 is expressed on activated lymphocytes and promotes homotypic B-cell adhesion.
11698418 2001 Activation of NK cell-mediated cytotoxicity by a SAP-independent receptor of the CD2 family.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11220635 2001 Molecular cloning of CS1, a novel human natural killer cell receptor belonging to the CD2 subset of the immunoglobulin superfamily.
11076863 2000 DNA cloning using in vitro site-specific recombination.