Property Summary

NCBI Gene PubMed Count 71
PubMed Score 641.53
PubTator Score 337.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 2.800 5.8e-04
osteosarcoma -3.507 9.9e-08
Atopic dermatitis 1.100 1.2e-04
interstitial cystitis 2.300 1.6e-03
primary Sjogren syndrome 1.600 3.8e-04
ulcerative colitis 1.600 1.9e-04
psoriasis 1.500 6.3e-60

Gene RIF (43)

PMID Text
26619119 results indicate that loss of SLAMF1 expression in chronic lymphocytic leukemia modulates genetic pathways
25920347 Data suggest that SLAMF1 is another significant piece in the intricate defective immune-regulatory function of patients with SLE.
25716736 Upstream open reading frames regulate translation of the long isoform of SLAMF1 mRNA that encodes costimulatory receptor CD150
24770789 Molecular dynamics analysis revealed that mutant R32Q and T53I structures of SAP exhibited structural variation with respect to their backbone atoms before and after binding with the unphosphorylated SLAM peptide.
24373350 Signaling lymphocytic activation molecule (SLAM)/SLAM-associated protein pathway regulates human B-cell tolerance.
24238277 Latent membrane protein 1 was responsible for the CD150 upregulation.
23554862 Experimental adaptation of wild-type canine distemper virus (CDV) to the human entry receptor CD150
22532682 HIV-1 infection induces a high level of SLAM expression on CD4(+) T cells, which may enhance their susceptibility to measles virus and exacerbate measles in coinfected individuals.
22493499 conclude that Slamf1 recruits a subset of Vps34-associated proteins, which is involved in membrane fusion and NOX2 regulation
22277902 the study demonstrates that variants of SLAMF1 and ITLN1, both implicated in inflammation, are associated with type 2 diabetes in Indians.
22194822 Two genes were consistently retained in the models with clinical variables: SKI (v-SKI avian sarcoma viral oncogene homolog) and SLAMF1 (signaling lymphocytic activation molecule family member 1; CD150).
22086389 Subjects previously immunized with measles-mumps-rubella vaccine were genotyped for 66 candidate single nucleotide polymorphisms in the CD46, SLAM and CD209 genes.
21450813 The simultaneous interaction of Measles virus glycoprotein-pseudotyped Lentivirus with both CD46 and SLAM is required to achieve efficient and stable transduction of B and T cells.
21423089 CD150 receptor could trigger PI3K-mediated Akt signaling pathway in normal, EBV-transformed and malignant B cells.
21357537 A role for SLAM in controlling natural killer T (NKT) cell development is consistent with a role in both positive and negative thymic selection of NKT cells in NOD mice.
20810499 Our findings suggest that -262A-188G haplotype in the SLAM gene promoter contributes to the risk of systemic lupus erythematosus by increasing the expression of SLAM.
20810499 Observational study of gene-disease association. (HuGE Navigator)
20618687 Apoptosis of measles virus-infected peripheral blood mononuclear cells is triggered by interaction between viral hemagglutinin protein and cellular receptor, SLAM.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20231852 CD150 may contribute to regulation of tumor cell maintenance in low-rate proliferating Hodgkin's lymphoma
20042501 Data show that measles virus infection of alveolar macrophages and subepithelial dendritic cells in the airways precedes infection of lymphocytes in lymphatic organs of mice expressing human SLAM with human-like tissue specificity.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19199539 The functional roles of interleukin-17, SLAM and CREB on IFN-gamma production in persons with tuberculosis are reported.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18287234 Measles virus can infect and produce syncytia in human polarized epithelial cell lines independently of SLAM and CD46 by using distinctive receptor-binding sites on its hemagglutinin.
17715217 SLAM and CD46 do not have a role in measles virus growth and syncytium formation in tumor cell lines
17692919 Enhancement of anti-tumor activity in vitro and in vivo by CD150 and SAP
17560639 SNPs present in both the SLAM and CD46 genes are associated with measurable and significant variations in antibody response after measles vaccination
16889684 We have identified several novel SLAM binding sites at residues 429, 436 and 437 of measles virus haemagglutin (MVH) protein and MVH mutants in these residues dramatically decrease the ability to interaction with the cell surface SLAM.
15661039 activation of peripheral blood cells with agonistic anti-CD3 antibody and exogenous IL-2, as used for generation of cytokine-induced killer cells, results in significant SLAM and SAP activation 5 days after TCR stimulation
15356162 During ligation of SLAM in leprosy, signaling molecules and transcription factors participate in the induction or reinforcement of interferon-gamma production, promoting cell-mediated immune responses to mycobacterial infection.
15315965 CD150 and SH2D1A are coexpressed during a narrow window of B-cell maturation and SH2D1A may be involved in regulation of B-cell differentiation via switching of CD150-mediated signaling pathways.
15308701 binding site with measles virus hemagglutinin: attachment sites for MV receptors SLAM and CD46 overlap on the globular head
15193925 murine Measles virus-infected dendritic cells expressing hSLAM receptor downregulated B7-1, B7-2, CD40, MHC class I, and MHC class II expresssion on their surfaces, increased their rate of apoptosis, and inhibited T-cell proliferation.
14707094 SLAM expression correlates directly with T cell responsiveness to Mycobacterium tuberculosis antigen.
14657878 SLAM mRNA expression in PBMC is modulated during the course of specific immunotherapy, and an early and transient increase of SLAM mRNA expression is associated with clinical symptom improvement
12610126 direct correlation between the amount of hSLAM expressed on the cells' surface and the degree of measles virus infection; MV infection induced downregulation of receptor hSLAM and inhibited cell division and proliferation of hSLAM(+)T cells
12458214 effect of X-linked lymphoproliferative syndrome gene product SAP/SH2D1A on signaling through signaling lymphocyte activation molecule family of immune receptors
12270725 Susceptibility of human dendritic cells (DCs) to measles virus (MV) depends on their activation stages in conjunction with the level of CDw150: role of Toll stimulators in DC maturation and MV amplification
11489980 SLAM contributes to the enhanced immunostimulatory functions of dendritic cells that are observed following the addition of IL-1 in vitro.

AA Sequence

MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSL      1 - 70
ENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQ     71 - 140
VSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICT    141 - 210
VSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTI    211 - 280
YAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES                   281 - 335
//

Text Mined References (76)

PMID Year Title
26619119 2016 SLAMF1 regulation of chemotaxis and autophagy determines CLL patient response.
25920347 2015 Analysis of expression and function of the co-stimulatory receptor SLAMF1 in immune cells from patients with systemic lupus erythematosus (SLE).
25716736 2014 Upstream open reading frames regulate translation of the long isoform of SLAMF1 mRNA that encodes costimulatory receptor CD150.
25710480 2015 Expression of CD150 in tumors of the central nervous system: identification of a novel isoform.
24770789 2014 Structural characterization of disease-causing mutations on SAP and the functional impact on the SLAM peptide: a molecular dynamics approach.
24373350 2014 Signaling lymphocytic activation molecule (SLAM)/SLAM-associated protein pathway regulates human B-cell tolerance.
24238277 2014 Enhanced susceptibility of B lymphoma cells to measles virus by Epstein-Barr virus type III latency that upregulates CD150/signaling lymphocytic activation molecule.
23554862 2013 Experimental adaptation of wild-type canine distemper virus (CDV) to the human entry receptor CD150.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22532682 2012 HIV-1 infection ex vivo accelerates measles virus infection by upregulating signaling lymphocytic activation molecule (SLAM) in CD4+ T cells.
22493499 2012 Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex.
22479419 2012 Genome-wide association study of treatment refractory schizophrenia in Han Chinese.
22277902 2012 Common variants of SLAMF1 and ITLN1 on 1q21 are associated with type 2 diabetes in Indian population.
22194822 2011 A two-gene signature, SKI and SLAMF1, predicts time-to-treatment in previously untreated patients with chronic lymphocytic leukemia.
22086389 2011 The association of CD46, SLAM and CD209 cellular receptor gene SNPs with variations in measles vaccine-induced immune responses: a replication study and examination of novel polymorphisms.
22048310 2011 Adherens junction protein nectin-4 is the epithelial receptor for measles virus.
21450813 2011 Measles virus glycoprotein-pseudotyped lentiviral vector-mediated gene transfer into quiescent lymphocytes requires binding to both SLAM and CD46 entry receptors.
21423089 2011 CD150-mediated Akt signalling pathway in normal and malignant B cells.
21357537 2011 Role of SLAM in NKT cell development revealed by transgenic complementation in NOD mice.
20818396 2010 SLAM is a microbial sensor that regulates bacterial phagosome functions in macrophages.
20810499 2010 Detection and functional evaluation of -262A/T and -188A/G polymorphisms of SLAM gene in patients with systemic lupus erythematosus.
20618687 2010 Apoptosis of human peripheral blood mononuclear cells by wild-type measles virus infection is induced by interaction of hemagglutinin protein and cellular receptor, SLAM via caspase-dependent pathway.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20231852 2010 CD150 regulates JNK1/2 activation in normal and Hodgkin's lymphoma B cells.
20042501 2010 Measles virus infection of alveolar macrophages and dendritic cells precedes spread to lymphatic organs in transgenic mice expressing human signaling lymphocytic activation molecule (SLAM, CD150).
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19199539 2009 IFN-gamma production during active tuberculosis is regulated by mechanisms that involve IL-17, SLAM, and CREB.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18287234 2008 Measles virus infects both polarized epithelial and immune cells by using distinctive receptor-binding sites on its hemagglutinin.
18020706 2007 Predominant infection of CD150+ lymphocytes and dendritic cells during measles virus infection of macaques.
17715217 2007 A human lung carcinoma cell line supports efficient measles virus growth and syncytium formation via a SLAM- and CD46-independent mechanism.
17692919 2008 Enhancement of anti-tumor activity in vitro and in vivo by CD150 and SAP.
17560639 2007 Variations in measles vaccine-specific humoral immunity by polymorphisms in SLAM and CD46 measles virus receptors.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16889684 2006 Identification of amino acid residues involved in the interaction between measles virus Haemagglutin (MVH) and its human cell receptor (signaling lymphocyte activation molecule, SLAM).
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16317102 2006 SLAM/SLAM interactions inhibit CD40-induced production of inflammatory cytokines in monocyte-derived dendritic cells.
15661039 2005 SAP and SLAM expression in anti-CD3 activated lymphocytes correlates with cytotoxic activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15356162 2004 Activation of signaling lymphocytic activation molecule triggers a signaling cascade that enhances Th1 responses in human intracellular infection.
15315965 2004 The adaptor protein SH2D1A regulates signaling through CD150 (SLAM) in B cells.
15308701 2004 Measles virus (MV) hemagglutinin: evidence that attachment sites for MV receptors SLAM and CD46 overlap on the globular head.
15193925 2004 Measles virus interacts with human SLAM receptor on dendritic cells to cause immunosuppression.
14707094 2004 Expression of signaling lymphocytic activation molecule-associated protein interrupts IFN-gamma production in human tuberculosis.
14674764 2003 Disease-causing SAP mutants are defective in ligand binding and protein folding.
14657878 2003 In vitro allergen-induced mRNA expression of signaling lymphocytic activation molecule by PBMC of patients with allergic rhinitis is increased during specific pollen immunotherapy.
12629654 2003 Absence of SLAM mutations in EBV-associated lymphoproliferative disease patients.
12621057 2003 The cell surface expression of SAP-binding receptor CD229 is regulated via its interaction with clathrin-associated adaptor complex 2 (AP-2).
12610126 2003 Measles virus infects and suppresses proliferation of T lymphocytes from transgenic mice bearing human signaling lymphocytic activation molecule.
12545174 2003 SAP couples Fyn to SLAM immune receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12458214 2003 Dual functional roles for the X-linked lymphoproliferative syndrome gene product SAP/SH2D1A in signaling through the signaling lymphocyte activation molecule (SLAM) family of immune receptors.
12270725 2002 Susceptibility of human dendritic cells (DCs) to measles virus (MV) depends on their activation stages in conjunction with the level of CDw150: role of Toll stimulators in DC maturation and MV amplification.
12225753 2002 Side-chain dynamics of the SAP SH2 domain correlate with a binding hot spot and a region with conformational plasticity.
11823424 2002 A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
11806999 2002 Molecular dissection of the signaling and costimulatory functions of CD150 (SLAM): CD150/SAP binding and CD150-mediated costimulation.
11689425 2001 Structural basis for the interaction of the free SH2 domain EAT-2 with SLAM receptors in hematopoietic cells.
11544303 2001 Signaling lymphocytic activation molecule is expressed on CD40 ligand-activated dendritic cells and directly augments production of inflammatory cytokines.
11489980 2001 Signaling lymphocytic activation molecule is expressed on mature CD83+ dendritic cells and is up-regulated by IL-1 beta.
11477068 2001 Characterization of SH2D1A missense mutations identified in X-linked lymphoproliferative disease patients.
11414741 2001 Distinct interactions of the X-linked lymphoproliferative syndrome gene product SAP with cytoplasmic domains of members of the CD2 receptor family.
11389028 2001 Cell surface receptors Ly-9 and CD84 recruit the X-linked lymphoproliferative disease gene product SAP.
11313386 2001 CD150 association with either the SH2-containing inositol phosphatase or the SH2-containing protein tyrosine phosphatase is regulated by the adaptor protein SH2D1A.
10972291 2000 SLAM (CDw150) is a cellular receptor for measles virus.
10802665 2000 Transcript imaging of the development of human T helper cells using oligonucleotide arrays.
10607564 1999 Novel mode of ligand binding by the SH2 domain of the human XLP disease gene product SAP/SH2D1A.
10549287 1999 Crystal structures of the XLP protein SAP reveal a class of SH2 domains with extended, phosphotyrosine-independent sequence recognition.
10229804 1999 CDw150 associates with src-homology 2-containing inositol phosphatase and modulates CD95-mediated apoptosis.
9774102 1998 The X-linked lymphoproliferative-disease gene product SAP regulates signals induced through the co-receptor SLAM.
9091591 1997 Soluble and membrane-bound forms of signaling lymphocytic activation molecule (SLAM) induce proliferation and Ig synthesis by activated human B lymphocytes.
7617038 1995 A novel receptor involved in T-cell activation.