Property Summary

NCBI Gene PubMed Count 79
PubMed Score 680.82
PubTator Score 337.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Atopic dermatitis 1.100 1.2e-04
cutaneous lupus erythematosus 2.800 5.8e-04
interstitial cystitis 1.700 1.4e-03
osteosarcoma -3.507 9.9e-08
primary Sjogren syndrome 1.600 3.8e-04
psoriasis 1.500 6.3e-60
ulcerative colitis 1.600 1.9e-04

Pathway (1)

PDB (10)

Gene RIF (47)

AA Sequence

MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSL      1 - 70
ENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQ     71 - 140
VSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICT    141 - 210
VSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTI    211 - 280
YAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES                   281 - 335
//

Text Mined References (84)

PMID Year Title