Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.20
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 1.9e-04
glioblastoma 1.400 1.2e-02
group 3 medulloblastoma 1.200 5.4e-04
medulloblastoma, large-cell 1.900 2.1e-06
non primary Sjogren syndrome sicca 1.200 1.7e-02
osteosarcoma 1.903 1.3e-04
pediatric high grade glioma 1.100 1.5e-02
posterior fossa group B ependymoma 1.200 6.9e-04
Rheumatoid arthritis 1.200 4.2e-02
spina bifida -1.051 1.4e-02

Gene RIF (3)

AA Sequence

MEDVNSNVNADQEVRKLQELVKKLEKQNEQLRSRSGAVQGAGSLGPGSPVRAGASIPSSGAASPRGFPLG      1 - 70
LSAKSGGGPGSGPRRTSSEELRDATSLLAAGEGGLLDEVEPLRPDELERLSGWEEEEESWLYSSPKKKLT     71 - 140
PMQKSVSPLVWCRQVLDYPSPDVECAKKSLIHKLDQTMSALKRQNLYNNPFNSMSYTSPYSPNASSPYSS    141 - 210
GFNSPSSTPVRPPIVKQLILPGNSGNLKSSDRNPPLSPQSSIDSELSASELDEDSIGSNYKLNDVTDVQI    211 - 280
LARMQEESLRQEYAATTSRRSSGSSCNSTRRGTFSDQELDAQSLDDEDDNMHHAVYPAVNRFSPSPRNSP    281 - 350
RPSPKQSPRNSPRSRSPARGIEYSRVSPQPMISRLQQPRLSLQGHPTDLQTSNVKNEEKLRRSLPNLSRT    351 - 420
SNTQVDSVKSSRSDSNFQVPNGGIPRMQPQASAIPSPGKFRSPAAPSPLALRQPVKAFSNHGSGSPGSQE    421 - 490
ITQLTQTTSSPGPPMVQSTVSANPPSNINSATLTRPAGTTAMRSGLPRPSAPSAGGIPVPRSKLAQPVRR    491 - 560
SLPAPKTYGSMKDDSWKDGCY                                                     561 - 581
//

Text Mined References (23)

PMID Year Title