Property Summary

NCBI Gene PubMed Count 27
PubMed Score 36.10
PubTator Score 610.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -1.300 3.9e-05
cutaneous lupus erythematosus 1.800 2.1e-04
psoriasis 1.600 2.3e-03
osteosarcoma -2.089 3.9e-03
glioblastoma 2.300 1.6e-04
adrenocortical carcinoma -1.682 1.7e-03
non-small cell lung cancer -1.506 3.3e-17
intraductal papillary-mucinous adenoma (... -1.100 8.1e-03
intraductal papillary-mucinous carcinoma... -1.700 2.9e-04
intraductal papillary-mucinous neoplasm ... -1.500 5.0e-03
lung cancer -2.900 1.3e-05
interstitial cystitis 1.900 6.2e-03
adult high grade glioma 1.300 8.4e-04
primary Sjogren syndrome 2.000 4.0e-04
subependymal giant cell astrocytoma 1.469 1.0e-02
lung adenocarcinoma -1.800 1.2e-12
invasive ductal carcinoma 2.018 4.9e-04
lung carcinoma -2.600 1.2e-23
spina bifida 1.231 1.4e-02
acute myeloid leukemia -2.700 1.6e-02
ulcerative colitis 2.200 3.5e-06

Gene RIF (8)

PMID Text
25800872 results suggest that cytoplasm-specific transduction of the SH3 and SH2 domains of SLAP has a therapeutic potential of being an immunosuppressive reagent for the treatment of various autoimmune diseases
24284075 Taken together the data demonstrate that SLAP negatively regulates wild-type c-Kit signaling, but not its oncogenic counterpart, indicating a possible mechanism by which the oncogenic c-Kit bypasses the normal cellular negative feedback control
23300935 upon ligand stimulation SLAP stably associates with Flt3 through multiple phosphotyrosine residues in Flt3. SLAP mRNA is differentially expressed in different cancers and its expression significantly increased in patients carrying the Flt3-ITD mutation
22798681 These data provide evidence for src-like adaptor protein-dependent regulation of CD3 zeta-chain in the fine control of TCR signaling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19631983 Although SLA is a prominent glucocorticoids response gene, it does not seem to contribute to the anti-leukemic effects of glucocorticoids.
19240061 Observational study of gene-disease association. (HuGE Navigator)
16521218 The SLA molecule and its functionally relevant residues have been highly conserved throughout the evolution.

AA Sequence

MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRES      1 - 70
YIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNN     71 - 140
WYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQED    141 - 210
PEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED        211 - 276
//

Text Mined References (32)

PMID Year Title
25800872 2015 Intracellular cytoplasm-specific delivery of SH3 and SH2 domains of SLAP inhibits TcR-mediated signaling.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24284075 2014 Src-like-adaptor protein (SLAP) differentially regulates normal and oncogenic c-Kit signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23612905 2013 Robust evidence for five new Graves' disease risk loci from a staged genome-wide association analysis.
23300935 2012 Src-Like adaptor protein (SLAP) binds to the receptor tyrosine kinase Flt3 and modulates receptor stability and downstream signaling.
22832960 2012 A genome-wide meta-analysis of association studies of Cloninger's Temperament Scales.
22798681 2012 CD3?-chain expression of human T lymphocytes is regulated by TNF via Src-like adaptor protein-dependent proteasomal degradation.
22561518 2012 Genome-wide association analyses identify 13 new susceptibility loci for generalized vitiligo.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19631983 2010 Functional analyses of Src-like adaptor (SLA), a glucocorticoid-regulated gene in acute lymphoblastic leukemia.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18088087 2008 Phosphoproteome of resting human platelets.
16521218 2006 Characterization of human gene encoding SLA/LP autoantigen and its conserved homologs in mouse, fish, fly, and worm.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15117958 2004 90-kDa ribosomal S6 kinase is a direct target for the nuclear fibroblast growth factor receptor 1 (FGFR1): role in FGFR1 signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11696592 2001 Functional cloning of Src-like adapter protein-2 (SLAP-2), a novel inhibitor of antigen receptor signaling.
11179692 2001 Characterization of promoter region and genomic structure of the murine and human genes encoding Src like adapter protein.
10779329 2000 Slap negatively regulates Src mitogenic function but does not revert Src-induced cell morphology changes.
10662792 2000 Src-like adaptor protein (SLAP) is a negative regulator of T cell receptor signaling.
10449770 1999 SLAP, a dimeric adapter protein, plays a functional role in T cell receptor signaling.
9742401 1998 Src-like adaptor protein (Slap) is a negative regulator of mitogenesis.
9660183 1998 The gene for the human Src-like adaptor protein (hSLAP) is located within the 64-kb intron of the thyroglobulin gene.
9020066 1997 Expression of Src-like adapter protein mRNA is induced by all-trans retinoic acid.
8825655 1995 Chromosomal localization of the mouse Src-like adapter protein (Slap) gene and its putative human homolog SLA.
7543898 1995 Characterization of a novel Src-like adapter protein that associates with the Eck receptor tyrosine kinase.