Property Summary

NCBI Gene PubMed Count 95
PubMed Score 58.59
PubTator Score 1052.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

 GWAS Trait (1)

Protein-protein Interaction (12)

Gene RIF (65)

PMID Text
26138431 Overexpression of Ski wild type, but not S326D and S383D mutants inhibited centrosome amplification and cellular transformation induced by AURKA.
25955797 our findings suggest that Ski represses TGF-b-induced EMT and invasion by inhibiting SMAD-dependent signaling in non-small cell lung cancer
25670202 Ski regulates Hippo and TAZ signaling to suppress breast cancer progression.
24736733 Eight recurrent and three novel SKI mutations from eleven SGS patients were located in the R-SMAD binding domain, except for one in the DHD domain.
24641900 acetaldehyde up-regulates COL1A2 by modulating the role of Ski and the expression of SMADs 3, 4, and 7.
24011664 c-Ski is an important regulator in the activation of CAFs and may serve as a potential therapeutic target to block breast cancer progression.
23892090 The 1p36.33-1p36.32 deletion encompassing SKI may represents a previous undescribed microdeletion disorder.
23809940 Overall, these studies demonstrate altered Ski protein levels, degradation and localization in human papillomavirus16-transformed human keratinocytes and in cervical cancer.
23441061 Ski expression is a novel negative feedback mechanism acting on retinoic acid signaling
23103230 our findings show that in-frame mutations in exon 1 of SKI cause Shprintzen-Goldberg syndrome (SGS).
23023332 We identified causative variation in ten individuals with SGS in the proto-oncogene SKI, a known repressor of TGF-beta activity.
22984993 The study data provide limited support for the hypothesis that common SKI variants are susceptibility factors for non-syndromic cleft lip/palate.
22853316 Transgenic K562 cells have distinct gene expression profiles both in steady state and during terminal erythroid differentiation, with GATA1s expression characterised by lack of repression of MYB, CCND2 and SKI.
22411991 A mutant SKI defective in transformation fails to increase p53 ubiquitination and is unable to increase MDM2 levels and to increase mono-sumoylation of Ubc9
22229264 Ski expression in breast neoplasms is associated with longer overall and disease-free survival.
22194822 Two genes were consistently retained in the models with clinical variables: SKI (v-SKI avian sarcoma viral oncogene homolog) and SLAMF1 (signaling lymphocytic activation molecule family member 1; CD150).
21685371 Forced expression of miR-29a down-regulated SKI and its target gene, Nr-CAM, whereas miR-29a inhibition induced SKI expression.
21600873 These data identify Ski as a novel target of Aurora A and contribute to an understanding of the role of these proteins in the mitotic process.
21466664 impairment of SKI expression is not the leading mechanism involved in the growth-suppressive effect of miR-155 found in this malignancy.
21149449 Suppression of p53 activity through the cooperative action of Ski and histone deacetylase SIRT1.
21107877 Ski correlated with poor survival in the patients with TGF-beta-positive advanced gastric cancer.
20959473 c-Ski overexpression is associated with tumor progression.
20853076 These results suggest that c-Ski is likely involved in the carcinogenesis of CCA induced by O. viverrini infection
20691163 the results suggest that association with Ski leads to inhibition of Siah2 E3 ubiquitin ligase activity and in this way, the Ski protein inhibits Siah2-mediated proteasomal degradation of HDAC3.
20672350 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20624875 Results identified serine 515 as a phosphorylation site of c-Ski which affects its electrophoretic motility.
20572854 Observational study of gene-disease association. (HuGE Navigator)
20404506 SKI promotes the switch of Smad3 from repressor of proliferation to activator of oncogenesis by facilitating phosphorylations in the linker domain.
19959502 findings show that Arkadia regulates the levels of expression of c-Ski protein in cell-type-dependent fashion, and exhibits a tumour suppressor function by inhibiting tumour cell growth
19875456 Akt modulates TGF-beta signaling by temporarily adjusting the levels of two TGF-beta pathway negative regulators, Ski and Smad7
19845874 Results indicate that SKI exploits multiple regulatory levels of the TGF-beta pathway and its deficiency restores TGF-beta tumor suppressor and apoptotic activities in spite of the likely presence of oncogenic mutations in melanoma tumors.
19594546 c-Ski overexpression promotes the growth of diffuse-type gastric carcinoma through induction of angiogenesis
19546161 Ski may act as a tumor proliferation-promoting factor or as a metastatic suppressor in human pancreatic cancer.
19341714 Ski can stabilize RARalpha and HDAC3 thus Ski represses retinoic acid signaling by stabilizing corepressor complex.
19112531 This study explores the association of STRA6 and SKI genes in a cohort of subjects with anophthalmia and microphthalmia.
19112531 Observational study of gene-disease association. (HuGE Navigator)
19096149 SnoN and Ski were overexpressed both in adenomas with severe dysplasia and colorectal carcinomas.
19049980 SKI and MEL1 knockdown synergistically restored TGF-beta responsiveness in MKN28 cells and reduced tumor growth in vivo
19032343 These results indicate that Ski complexes serve to maintain a TGF-beta-responsive promoter at a repressed basal level via the activities of histone deacetylase and histone arginine methyltransferase.
18782659 c-Ski and SnoN, mediators in TGF-beta resistance, might be implicated in melanoma growth and progression.
18508800 Ski is expressed in patients with acute myeloid leukemia treated with all-trans retinoic acid
18451154 The ability of TGF-beta to induce degradation of Ski could be an additional mechanism contributing to its protumorigenic activity.
18261624 Ski and SnoN proteins are overexpressed in Barrett's esophagus
17621263 Ski-mediated repression of PU.1 is due to Ski's ability to recruit histone deacetylase 3 to PU.1 bound to DNA.
17592292 Inhibition of Ski through RNA interference restored TGF-beta signaling and growth inhibition in vitro, and decreased tumor growth in vivo.
17469184 These results indicate that impaired competition with p300 is the possible cause of dysfunction of c-Ski/SnoN in scleroderma fibroblasts and that this might contribute to maintenance of the autocrine TGFbeta loop in this disease.
17054724 subcellular localization of c-Ski may be regulated by proteasome-sensitive processes through amino acid residues 94-210 and 491-548
16424870 Ski seems to be involved in the blocking of differentiation in AML via inhibition of RARalpha signaling
16327884 Observational study of gene-disease association. (HuGE Navigator)
16054854 Observational study of gene-disease association. (HuGE Navigator)
16054854 a novel polymorphism of the SKI gene was found to be associated with a decreased risk for orofacial defects
15806149 Ski's increased level and specific relocalization during mitosis
15542823 Ski cooperates in the process of transformation in erythroid cells by interfering with GATA1 function
15312649 Functional Ski overexpression inhibits TGF-beta-mediated proliferation and prevents growth-arrested Schwann cells from reentering the cell cycle.
15128733 ski is repressed by Smad7
15122324 Our data suggest that regulated proteolysis of Ski is one of the key mechanisms that control the threshold levels of this proto-oncoprotein, and thus prevents epithelial cells from becoming TGF-beta resistant.
15107821 These results suggest that stabilization of inactive Smad complexes on DNA is a critical event in c-Ski-mediated inhibition of TGF-beta signaling.
14712482 c-Ski protein has a role as a transcriptional co-repressor in TGF-beta signaling in esophageal squamous cell carcinoma
14583455 SKI regulates crucial events required for melanoma growth, survival, and invasion.
12874272 c-ski and HIPK2 play an important role in the negative regulation of BMP-induced transcriptional activation
12793438 I discuss the basis for repression of intracellular TGF-beta signaling by SKI, some additional activities of this protein, and propose that by disrupting multiple tumor suppressor pathways, SKI functions as a melanoma oncogene.
12764135 the ability of Ski and SnoN to repress the growth inhibitory function of the Smad proteins is required for their transforming activity.
12419246 determined the crystal structure of a complex between a conserved Smad4 binding fragment of Ski and the MH2 domain of Smad4 at 2.85 A resolution
12034730 c-Jun associates with the oncoprotein Ski and suppresses Smad2 transcriptional activity

AA Sequence

MEAAAGGRGCFQPHPGLQKTLEQFHLSSMSSLGGPAAFSARWAQEAYKKESAKEAGAAAVPAPVPAATEP      1 - 70
PPVLHLPAIQPPPPVLPGPFFMPSDRSTERCETVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQIN     71 - 140
AVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALG    141 - 210
LELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSAN    211 - 280
WRAYILLSQDYTGKEEQARLGRCLDDVKEKFDYGNKYKRRVPRVSSEPPASIRPKTDDTSSQSPAPSEKD    281 - 350
KPSSWLRTLAGSSNKSLGCVHPRQRLSAFRPWSPAVSASEKELSPHLPALIRDSFYSYKSFETAVAPNVA    351 - 420
LAPPAQQKVVSSPPCAAAVSRAPEPLATCTQPRKRKLTVDTPGAPETLAPVAAPEEDKDSEAEVEVESRE    421 - 490
EFTSSLSSLSSPSFTSSSSAKDLGSPGARALPSAVPDAAAPADAPSGLEAELEHLRQALEGGLDTKEAKE    491 - 560
KFLHEVVKMRVKQEEKLSAALQAKRSLHQELEFLRVAKKEKLREATEAKRNLRKEIERLRAENEKKMKEA    561 - 630
NESRLRLKRELEQARQARVCDKGCEAGRLRAKYSAQIEDLQVKLQHAEADREQLRADLLREREAREHLEK    631 - 700
VVKELQEQLWPRARPEAAGSEGAAELEP                                              701 - 728
//

Text Mined References (98)

PMID Year Title
26138431 2016 The Ski Protein is Involved in the Transformation Pathway of Aurora Kinase A.
25955797 2015 Ski prevents TGF-?-induced EMT and cell invasion by repressing SMAD-dependent signaling in non-small cell lung cancer.
25670202 2015 Ski regulates Hippo and TAZ signaling to suppress breast cancer progression.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24736733 2015 The SMAD-binding domain of SKI: a hotspot for de novo mutations causing Shprintzen-Goldberg syndrome.
24641900 2014 Mechanisms of action of acetaldehyde in the up-regulation of the human ?2(I) collagen gene in hepatic stellate cells: key roles of Ski, SMAD3, SMAD4, and SMAD7.
24357594 2014 De novo exon 1 missense mutations of SKI and Shprintzen-Goldberg syndrome: two new cases and a clinical review.
24011664 2013 c-Ski activates cancer-associated fibroblasts to regulate breast cancer cell invasion.
23892090 2013 576 kb deletion in 1p36.33-p36.32 containing SKI is associated with limb malformation, congenital heart disease and epilepsy.
23809940 2013 Ski protein levels increase during in vitro progression of HPV16-immortalized human keratinocytes and in cervical cancer.
23610558 2013 Rnf165/Ark2C enhances BMP-Smad signaling to mediate motor axon extension.
23441061 2013 Expression of Ski can act as a negative feedback mechanism on retinoic acid signaling.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23103230 2012 In-frame mutations in exon 1 of SKI cause dominant Shprintzen-Goldberg syndrome.
23023332 2012 Mutations in the TGF-? repressor SKI cause Shprintzen-Goldberg syndrome with aortic aneurysm.
22984993 2012 Evaluating SKI as a candidate gene for non-syndromic cleft lip with or without cleft palate.
22853316 2012 The GATA1s isoform is normally down-regulated during terminal haematopoietic differentiation and over-expression leads to failure to repress MYB, CCND2 and SKI during erythroid differentiation of K562 cells.
22442258 2012 Intercellular variation in signaling through the TGF-? pathway and its relation to cell density and cell cycle phase.
22411991 2012 Overexpression of SKI oncoprotein leads to p53 degradation through regulation of MDM2 protein sumoylation.
22229264 2012 Differential effect of the expression of TGF-? pathway inhibitors, Smad-7 and Ski, on invasive breast carcinomas: relation to biologic behavior.
22194822 2011 A two-gene signature, SKI and SLAMF1, predicts time-to-treatment in previously untreated patients with chronic lymphocytic leukemia.
21685371 2011 MicroRNA29a regulates the expression of the nuclear oncogene Ski.
21600873 2011 Identification of Ski as a target for Aurora A kinase.
21466664 2011 MicroRNA-155 targets the SKI gene in human melanoma cell lines.
21149449 2011 Suppression of p53 activity through the cooperative action of Ski and histone deacetylase SIRT1.
21107877 2011 Expression of thrombospondin-1 and Ski are prognostic factors in advanced gastric cancer.
20959473 2010 The oncoprotein c-ski functions as a direct antagonist of the transforming growth factor-{beta} type I receptor.
20853076 2011 Involvement of c-Ski oncoprotein in carcinogenesis of cholangiocacinoma induced by Opisthorchis viverrini and N-nitrosodimethylamine.
20691163 2010 The Ski protein negatively regulates Siah2-mediated HDAC3 degradation.
20672350 2010 Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20624875 2010 Identification of a phosphorylation site in c-Ski as serine 515.
20572854 2010 MTHFR and MSX1 contribute to the risk of nonsyndromic cleft lip/palate.
20404506 2010 SKI promotes Smad3 linker phosphorylations associated with the tumor-promoting trait of TGFbeta.
19959502 2010 Context-dependent regulation of the expression of c-Ski protein by Arkadia in human cancer cells.
19875456 2009 The phosphatidylinositol 3-kinase/Akt pathway regulates transforming growth factor-{beta} signaling by destabilizing ski and inducing Smad7.
19845874 2009 SKI knockdown inhibits human melanoma tumor growth in vivo.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19594546 2009 c-Ski overexpression promotes tumor growth and angiogenesis through inhibition of transforming growth factor-beta signaling in diffuse-type gastric carcinoma.
19546161 2009 Dual role of Ski in pancreatic cancer cells: tumor-promoting versus metastasis-suppressive function.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19341714 2009 The Ski protein can inhibit ligand induced RARalpha and HDAC3 degradation in the retinoic acid signaling pathway.
19112531 2008 Identification of STRA6 and SKI sequence variants in patients with anophthalmia/microphthalmia.
19096149 2009 TGF-beta repressors SnoN and Ski are implicated in human colorectal carcinogenesis.
19049980 2009 SKI and MEL1 cooperate to inhibit transforming growth factor-beta signal in gastric cancer cells.
19032343 2009 Ski co-repressor complexes maintain the basal repressed state of the TGF-beta target gene, SMAD7, via HDAC3 and PRMT5.
19008232 2009 Ski regulates muscle terminal differentiation by transcriptional activation of Myog in a complex with Six1 and Eya3.
18782659 2009 Clinical significance of the expression of c-Ski and SnoN, possible mediators in TGF-beta resistance, in primary cutaneous melanoma.
18508800 2008 Expression of the nuclear oncogene Ski in patients with acute myeloid leukemia treated with all-trans retinoic acid.
18451154 2008 Transforming growth factor-beta suppresses the ability of Ski to inhibit tumor metastasis by inducing its degradation.
18261624 2008 Ski/SnoN expression in the sequence metaplasia-dysplasia-adenocarcinoma of Barrett's esophagus.
17621263 2008 Ski can negatively regulates macrophage differentiation through its interaction with PU.1.
17592292 2007 Ski promotes tumor growth through abrogation of transforming growth factor-beta signaling in pancreatic cancer.
17510063 2007 Arkadia induces degradation of SnoN and c-Ski to enhance transforming growth factor-beta signaling.
17469184 2007 Involvement of the constitutive complex formation of c-Ski/SnoN with Smads in the impaired negative feedback regulation of transforming growth factor beta signaling in scleroderma fibroblasts.
17054724 2006 Nuclear and cytoplasmic c-Ski differently modulate cellular functions.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16424870 2006 Inhibition of retinoic acid receptor signaling by Ski in acute myeloid leukemia.
16327884 2005 Medical sequencing of candidate genes for nonsyndromic cleft lip and palate.
16054854 2005 Genetic variation in the proto-oncogene SKI and risk for orofacial clefting.
15806149 2005 The Ski oncoprotein is upregulated and localized at the centrosomes and mitotic spindle during mitosis.
15621726 2004 Bone morphogenetic proteins.
15542823 2004 Ski negatively regulates erythroid differentiation through its interaction with GATA1.
15312649 2004 The protooncogene Ski controls Schwann cell proliferation and myelination.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15128733 2004 Repression of endogenous Smad7 by Ski.
15122324 2004 Control of cell cycle-dependent degradation of c-Ski proto-oncoprotein by Cdc34.
15107821 2004 c-Ski inhibits the TGF-beta signaling pathway through stabilization of inactive Smad complexes on Smad-binding elements.
14712482 2004 Increased expression of c-Ski as a co-repressor in transforming growth factor-beta signaling correlates with progression of esophageal squamous cell carcinoma.
14699069 2004 Interaction with Smad4 is indispensable for suppression of BMP signaling by c-Ski.
14583455 2003 SKI activates Wnt/beta-catenin signaling in human melanoma.
14525983 2003 DACH1 inhibits transforming growth factor-beta signaling through binding Smad4.
12874272 2003 Requirement of the co-repressor homeodomain-interacting protein kinase 2 for ski-mediated inhibition of bone morphogenetic protein-induced transcriptional activation.
12857746 2003 Direct interaction of Ski with either Smad3 or Smad4 is necessary and sufficient for Ski-mediated repression of transforming growth factor-beta signaling.
12793438 2003 Repression of TGF-beta signaling by the oncogenic protein SKI in human melanomas: consequences for proliferation, survival, and metastasis.
12764135 2003 The transforming activity of Ski and SnoN is dependent on their ability to repress the activity of Smad proteins.
12646588 2003 The Ski-binding protein C184M negatively regulates tumor growth factor-beta signaling by sequestering the Smad proteins in the cytoplasm.
12435627 2002 Ski is involved in transcriptional regulation by the repressor and full-length forms of Gli3.
12419246 2002 Structural mechanism of Smad4 recognition by the nuclear oncoprotein Ski: insights on Ski-mediated repression of TGF-beta signaling.
12034730 2002 c-Jun associates with the oncoprotein Ski and suppresses Smad2 transcriptional activity.
11719430 2001 Cytoplasmic localization of the oncogenic protein Ski in human cutaneous melanomas in vivo: functional implications for transforming growth factor beta signaling.
11522815 2001 Ski interacts with the evolutionarily conserved SNW domain of Skip.
11441023 2001 The Ski protein family is required for MeCP2-mediated transcriptional repression.
11430826 2001 Role of PML and PML-RARalpha in Mad-mediated transcriptional repression.
11121043 2000 Ski represses bone morphogenic protein signaling in Xenopus and mammalian cells.
10823891 2000 The Huntington's disease protein interacts with p53 and CREB-binding protein and represses transcription.
10575014 1999 c-Ski acts as a transcriptional co-repressor in transforming growth factor-beta signaling through interaction with smads.
10549282 1999 Interaction of the Ski oncoprotein with Smad3 regulates TGF-beta signaling.
10485843 1999 The Ski oncoprotein interacts with the Smad proteins to repress TGFbeta signaling.
10049357 1999 Ski is a component of the histone deacetylase complex required for transcriptional repression by Mad and thyroid hormone receptor.
9927733 1999 Heterodimers of the SnoN and Ski oncoproteins form preferentially over homodimers and are more potent transforming agents.
9569025 1998 The Ski oncoprotein interacts with Skip, the human homolog of Drosophila Bx42.
9380514 1997 DNA binding and transcriptional activation by the Ski oncoprotein mediated by interaction with NFI.
8514802 1993 Complex formation between proteins encoded by the ski gene family.
8233802 1993 SnoI, a novel alternatively spliced isoform of the ski protooncogene homolog, sno.
3026737 1986 The cellular homologue of the transforming gene of SKV avian retrovirus maps to human chromosome region 1q22----q24.
2762147 1989 Isolation of human cDNA clones of ski and the ski-related gene, sno.