Property Summary

NCBI Gene PubMed Count 30
PubMed Score 571.71
PubTator Score 62.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Type 1 diabetes mellitus 109 0.0 3.0

Expression

  Differential Expression (29)

Disease log2 FC p
acute quadriplegic myopathy 1.360 3.6e-04
astrocytic glioma -1.900 2.3e-02
atypical teratoid / rhabdoid tumor -1.900 1.7e-05
Breast cancer -1.100 2.8e-10
ductal carcinoma in situ -1.100 4.8e-03
gastric carcinoma 1.700 4.3e-02
glioblastoma 1.300 3.6e-02
group 4 medulloblastoma -2.000 3.2e-04
intraductal papillary-mucinous adenoma (... 1.200 4.8e-02
intraductal papillary-mucinous carcinoma... 1.600 2.6e-02
intraductal papillary-mucinous neoplasm ... 2.200 1.2e-02
invasive ductal carcinoma -1.100 1.0e-02
juvenile dermatomyositis 1.012 2.0e-05
lung cancer -1.100 5.2e-03
lung carcinoma -2.000 5.6e-26
malignant mesothelioma -1.300 1.9e-05
medulloblastoma, large-cell -2.700 5.9e-05
oligodendroglioma -1.500 1.5e-06
osteosarcoma -1.439 2.9e-03
ovarian cancer -2.300 2.3e-07
pancreatic cancer 1.200 1.1e-04
pituitary cancer -1.900 1.4e-07
posterior fossa group A ependymoma 1.700 2.2e-03
primary pancreatic ductal adenocarcinoma 2.193 3.3e-04
primary Sjogren syndrome 1.400 5.2e-03
primitive neuroectodermal tumor -1.600 1.7e-02
psoriasis -1.700 7.2e-04
tuberculosis 2.300 8.6e-08
Waldenstrons macroglobulinemia 1.296 7.3e-03

Gene RIF (11)

AA Sequence

MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAE      1 - 70
DGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKR     71 - 140
WCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEW    141 - 210
VQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQR    211 - 280
KMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPK    281 - 350
AYIMEMYDI                                                                 351 - 359
//

Text Mined References (34)

PMID Year Title