Property Summary

NCBI Gene PubMed Count 29
PubMed Score 23.55
PubTator Score 22.54

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.180 5.7e-05
tuberculosis 1.400 1.6e-07
lung cancer -1.800 1.3e-05
lung carcinoma 1.200 4.0e-11
acute myeloid leukemia -1.100 3.0e-02
ovarian cancer 1.200 2.8e-04
Breast cancer -1.200 5.1e-03

Gene RIF (15)

PMID Text
24368808 SKAP55 dimers stabilize SLP-76 microclusters, couple SLP-76 to the force-generating systems responsible for microcluster movement, and enable adhesion via the TCR by mechanisms independent of RIAM, talin, and beta1 integrins.
24162774 HIV-1 gp120 downregulates the expression of src kinase associated phosphoprotein 1 (SKAP1) in human B cells
21669874 N-terminal myr-tagged SKAP1 for membrane binding facilitated constitutive RapL membrane and Rap1 binding and effectively substituted for PI3K and TCR ligation in the activation of LFA-1 in T cells.
21652578 single-nucleotide polymorphisms in ARRDC3, FLT1, and SKAP1 were significant predictors for survival androgen-deprivation therapy in prostate cancer patients.
20852632 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20852632 Single nucleotide polymorphism in SKAP1 is associated with ovarian cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346707 findings define a T cell receptor "inside-out" pathway via N-SKAP1-C-RapL that regulates T cell adhesion, motility, and arrest times with dendritic cells in lymph nodes.
19667759 SKAP1 protein as a novel regulator of the metaphase-to-anaphase transition and demonstrates that misregulation of the separase activation results in a reduced fidelity of chromosome segregation and a reduced genomic stability independent of the SAC.
17658605 These results suggest that SKAP55 modulates signal transduction from the T cell antigen receptor to Ras by binding to RasGRP1.
16461356 This study reports on a RKXXY294 motif in SKAP-55 that mediates unique ADAP SH3c domain binding; it is necessary for LFA-1-mediated adhesion and cytokine production.
15849195 stimuli that signal for the stabilization of SKAP55 may play an important role in T cell adhesion and conjugate formation
12652296 SKAP-55 regulates integrin-mediated adhesion and conjugate formation between T cells and antigen-presenting cells
12171928 observation that adapter protein SKAP55 formed homodimers through its SH3 domain and SK region
11909961 SKAP55 coupled with CD45 positively regulates T-cell receptor-mediated gene transcription.

AA Sequence

MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDD      1 - 70
NHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLF     71 - 140
YYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLK    141 - 210
DLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHD    211 - 280
LEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYL    281 - 350
TTAFEVEER                                                                 351 - 359
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24368808 2013 The N terminus of SKAP55 enables T cell adhesion to TCR and integrin ligands via distinct mechanisms.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
22949513 2012 Genome-wide association analysis of genetic generalized epilepsies implicates susceptibility loci at 1q43, 2p16.1, 2q22.3 and 17q21.32.
21669874 2011 SKAP1 protein PH domain determines RapL membrane localization and Rap1 protein complex formation for T cell receptor (TCR) activation of LFA-1.
21652578 2012 Genetic polymorphisms in androgen receptor-binding sites predict survival in prostate cancer patients receiving androgen-deprivation therapy.
20852632 2010 A genome-wide association study identifies susceptibility loci for ovarian cancer at 2q31 and 8q24.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20346707 2010 T cell receptor "inside-out" pathway via signaling module SKAP1-RapL regulates T cell motility and interactions in lymph nodes.
19798671 2009 A novel S3S-TAP-tag for the isolation of T-cell interaction partners of adhesion and degranulation promoting adaptor protein.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19667759 2009 SKAP associates with kinetochores and promotes the metaphase-to-anaphase transition.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17658605 2008 SKAP55 modulates T cell antigen receptor-induced activation of the Ras-Erk-AP1 pathway by binding RasGRP1.
16980616 2006 The ADAP/SKAP55 signaling module regulates T-cell receptor-mediated integrin activation through plasma membrane targeting of Rap1.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16461356 2006 Regulation and function of SKAP-55 non-canonical motif binding to the SH3c domain of adhesion and degranulation-promoting adaptor protein.
15939789 2005 An essential role for SKAP-55 in LFA-1 clustering on T cells that cannot be substituted by SKAP-55R.
15849195 2005 Deficiency of ADAP/Fyb/SLAP-130 destabilizes SKAP55 in Jurkat T cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12652296 2003 SKAP-55 regulates integrin adhesion and formation of T cell-APC conjugates.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12171928 2002 SKAP55 recruits to lipid rafts and positively mediates the MAPK pathway upon T cell receptor activation.
11909961 2002 SKAP55 coupled with CD45 positively regulates T-cell receptor-mediated gene transcription.
10856234 2000 SH3 domain recognition of a proline-independent tyrosine-based RKxxYxxY motif in immune cell adaptor SKAP55.
10358754 1999 Integration of T cell receptor-dependent signaling pathways by adapter proteins.
9837776 1998 RA70 is a src kinase-associated protein expressed ubiquitously.
9748251 1998 Molecular interaction between the Fyn-associated protein SKAP55 and the SLP-76-associated phosphoprotein SLAP-130.
9671755 1998 FYB (FYN binding protein) serves as a binding partner for lymphoid protein and FYN kinase substrate SKAP55 and a SKAP55-related protein in T cells.
9232446 1997 Molecular analysis of the fyn-complex: cloning of SKAP55 and SLAP-130, two novel adaptor proteins which associate with fyn and may participate in the regulation of T cell receptor-mediated signaling.
9195899 1997 Molecular cloning of SKAP55, a novel protein that associates with the protein tyrosine kinase p59fyn in human T-lymphocytes.