Property Summary

NCBI Gene PubMed Count 21
PubMed Score 27.31
PubTator Score 18.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.355 2.4e-03
glioblastoma 1.800 5.3e-04
group 3 medulloblastoma 2.000 1.5e-05
atypical teratoid / rhabdoid tumor 1.400 2.4e-05
medulloblastoma, large-cell 1.900 1.0e-05
primitive neuroectodermal tumor 1.700 1.3e-04
lung cancer 1.600 1.1e-02
pediatric high grade glioma 1.500 7.3e-05
psoriasis 1.700 1.3e-140

 GO Function (1)

Protein-protein Interaction (9)

Gene RIF (12)

PMID Text
26797278 Thus, our findings identified a definite regulatory mechanism of the search and capture process for stable spindle attachment through cross-talk between spindle dynamics and KT composition mediated by DDA3 and Ska1.
26197237 knockdown of SKA1 could potently suppress bladder cancer cell proliferation in vitro and lentivirus-mediated silencing of SKA1 might serve as a novel strategy for gene therapy of bladder cancer.
26063960 Results show that high SKA1 expression is predictive of poor prognosis of papillary thyroid carcinoma (PTC), implying it as a promising new target for PTC therapies.
24827423 Ska1 over-expression promotes tumourigenesis
24627241 SKA1 could be used for gastric cancer early diagnosis as a biomarker.
24413531 the kinetochore-associated Ska complex interacts with tubulin monomers via the carboxy-terminal winged-helix domain of Ska1, providing the structural basis for the ability to bind both straight and curved microtubule structures.
24010405 Data suggest that SKA1 plays an important role in the proliferation of hepatocellular carcinoma cells
23085020 the conserved kinetochore-localized Ska1 complex tracks with depolymerizing microtubule ends and associates with both the microtubule lattice and curved protofilaments
22483620 The structure of the Ska core complex is a W-shaped dimer of coiled coils, formed by intertwined interactions between Ska1, Ska2, and Ska3.
22371557 Data suggest that Aurora B phosphorylation antagonizes the interaction between the Ska1-3 complex and the KMN network, thereby controlling Ska recruitment to KTs and stabilization of KT-MT attachments.
19289083 The full Ska1 complex forms assemblies on microtubules that can facilitate the processive movement of microspheres along depolymerizing microtubules.
17093495 These data suggest that the Ska1/Ska2 complex plays a critical role in the maintenance of the metaphase plate and/or spindle checkpoint silencing.

AA Sequence

MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSL      1 - 70
KELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFI     71 - 140
TCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYF    141 - 210
IVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT                             211 - 255
//

Text Mined References (24)

PMID Year Title
26797278 2016 Ska1 cooperates with DDA3 for spindle dynamics and spindle attachment to kinetochore.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26197237 2015 Downregulation of SKA1 Gene Expression Inhibits Cell Growth in Human Bladder Cancer.
26063960 2015 Expression of Spindle and Kinetochore-Associated Protein 1 Is Associated with Poor Prognosis in Papillary Thyroid Carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24827423 2014 SKA1 over-expression promotes centriole over-duplication, centrosome amplification and prostate tumourigenesis.
24627241 2014 Spindle and kinetochore-associated protein 1 is overexpressed in gastric cancer and modulates cell growth.
24413531 2014 Structural basis for microtubule recognition by the human kinetochore Ska complex.
24010405 2013 Effects of short interfering RNA-mediated gene silencing of SKA1 on proliferation of hepatocellular carcinoma cells.
23085020 2012 The kinetochore-bound Ska1 complex tracks depolymerizing microtubules and binds to curved protofilaments.
22483620 2012 Structural and functional organization of the Ska complex, a key component of the kinetochore-microtubule interface.
22371557 2012 Aurora B controls kinetochore-microtubule attachments by inhibiting Ska complex-KMN network interaction.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19360002 2009 Stable kinetochore-microtubule interactions depend on the Ska complex and its new component Ska3/C13Orf3.
19289083 2009 The human kinetochore Ska1 complex facilitates microtubule depolymerization-coupled motility.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17093495 2006 Timely anaphase onset requires a novel spindle and kinetochore complex comprising Ska1 and Ska2.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15561729 2005 Proteome analysis of the human mitotic spindle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.