Property Summary

NCBI Gene PubMed Count 41
PubMed Score 686.80
PubTator Score 161.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 1.2

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.800 2.9e-03
group 3 medulloblastoma 2.500 4.5e-03
medulloblastoma, large-cell 2.900 4.0e-04
pituitary cancer -1.200 6.6e-04
primitive neuroectodermal tumor 3.500 8.9e-03
psoriasis -1.600 2.9e-08

 GO Component (1)

Gene RIF (25)

AA Sequence

MVFRSPLDLYSSHFLLPNFADSHHRSILLASSGGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGGS      1 - 70
RAPPEELSMFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAF     71 - 140
HTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKT    141 - 210
HCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQHQAIGPSGM    211 - 280
RSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDSECDV                      281 - 332
//

Text Mined References (42)

PMID Year Title