Property Summary

NCBI Gene PubMed Count 37
PubMed Score 66.31
PubTator Score 65.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.133 5.5e-03
group 3 medulloblastoma 1.200 1.9e-03
non primary Sjogren syndrome sicca 1.300 2.4e-02

Gene RIF (25)

PMID Text
26406409 Loss of SIVA1 expression is associated with nasopharyngeal carcinoma.
25813352 These findings collectively reveal a novel role for the p53 target gene SIVA both in regulating metabolism and in enabling tumorigenesis, independently of p53.
25431847 electrical stimulation -inducible SIVA1 modulates p53 activities in proliferating keratinocytes, and exogenous electrical stimulation affects p53/HDM2/SIVA1 axis leading to increased proliferation during re-epithelialization
25374190 Functional test demonstrated that Siva1 significantly inhibited the invasion and migration of HCT116 cells.
24958773 SIVA1 interacts with RAD18 and serves as a molecular bridge between RAD18 and PCNA, thus targeting the E3 ligase activity of RAD18 onto PCNA.
23462994 Siva1 promotes the ubiquitination and degradation of ARF, which in turn affects the stability of p53.
22343716 Upon stimulation of thromboxane A2, degradation of Siva1 is impeded, resulting in an accumulation of the protein, which translocates from the nucleus to the cytosol.
21955384 negative regulator of IL-2 gene expression in Treg cells
21768358 Data show that low levels of Siva1 and Ser16-phosphorylated stathmin correlate with high metastatic states of breast cancer cells.
21048035 These findings suggest that the caspase-dependent pathway for induction of apoptosis is involved in Siva-1-mediated influenza A virus replication.
20934406 These results suggest that Siva-mediated unprovoked apoptosis is not likely to be involved in the pathogenesis of Familial Mediterranean fever.
20727854 Siva-1 forms a functional complex with Tyk2 and participates in the transduction of signals that inhibit B lymphocyte growth.
19590512 Siva1 is an important mediator for the Hdm2-p53 interaction and is an integral component of the negative feedback mechanism for p53 inhibition.
19460752 Knockdown of SIVA1, apoptosis-inducing factor (SIVA1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19392652 Siva-1 has a role in negatively regulating NF-kappaB activation by targeting TRAF2.
18849585 Telethonin might be involved in CVB3-mediated cell damage and in the resulting cardiac dysfunction due to the interaction with Siva.
18330885 Data show that Siva and pyrin are co-expressed, and that pyrin modulates the apoptotic response to oxidative stress mediated by Siva.
17965021 lysophosphatidic acid 2 receptor mediates down-regulation of Siva-1 to promote cell survival
17653867 Results suggest that Siva-1 might participate in the CD4-initiated signaling apoptotic pathway induced by the HIV-1 envelope in T-lymphoid cells.
17653867 Siva-1 sensitizes CD4-positive T-cells to HIV-1 gp120/gp41-induced apoptosis. The Siva-1-mediated sensitization on CD4-positive T-cells shows significant activation of caspase-3, -8, and -9
17348035 Confirming the anti-apoptotic role of HPV-16 E7 in the HaCaT cellular model, evaluated by nuclear morphology, it was also found that Siva-1 expression produced a significant increase of the apoptotic rate in UV radiation-exposed HaCaT cells.
16683188 determined the N-terminal part of Siva as the binding region for CD27; the peroxisomal membrane protein PMP22 is a new interaction partner of Siva and may be involved in the host response against CVB3.
16491128 Siva-1 has a role, through its inhibitory effect on NF-kappaB activity, in TCR-mediated AICD with implications in peripheral tolerance, T-cell homeostasis and cancer
15034012 Overexpression of Siva-1 in T lymphocytes triggers the activation of a caspase-dependent death pathway including a pivotal mitochondrial step. Both N- and C-terminal domains of Siva proteins display the ability to induce a cell death process in T cells.
14739602 Siva-1 putative amphipathic helical region (SAH) binds BCL-XL and sensitizes cells to UV radiation induced apoptosis

AA Sequence

MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPES      1 - 70
PKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVR     71 - 140
TCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET                                       141 - 175
//

Text Mined References (38)

PMID Year Title
26406409 2015 Anticancer activity of recombinant Siva1 protein in human nasopharyngeal carcinoma cell line CNE-2.
25813352 2015 The p53 Target Gene SIVA Enables Non-Small Cell Lung Cancer Development.
25431847 2015 Electrical stimulation enhances epidermal proliferation in human cutaneous wounds by modulating p53-SIVA1 interaction.
25374190 2014 Preliminary research on the expression, purification and function of the apoptotic fusion protein, Sival.
24958773 2014 SIVA1 directs the E3 ubiquitin ligase RAD18 for PCNA monoubiquitination.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23462994 2013 Siva1 inhibits p53 function by acting as an ARF E3 ubiquitin ligase.
22343716 2012 Thromboxane A2 modulates cisplatin-induced apoptosis through a Siva1-dependent mechanism.
21955384 2011 Regulation of IL-2 gene expression by Siva and FOXP3 in human T cells.
21768358 2011 Siva1 suppresses epithelial-mesenchymal transition and metastasis of tumor cells by inhibiting stathmin and stabilizing microtubules.
21048035 2011 Requirement for Siva-1 for replication of influenza A virus through apoptosis induction.
20934406 2010 The role of the pro-apoptotic protein Siva in the pathogenesis of Familial Mediterranean fever: A structural and functional analysis.
20727854 2010 Tyrosine kinase 2 interacts with the proapoptotic protein Siva-1 and augments its apoptotic functions.
19590512 2009 Suppression of p53 activity by Siva1.
19392652 2009 Siva-1 promotes K-48 polyubiquitination of TRAF2 and inhibits TCR-mediated activation of NF-kappaB.
18849585 2009 Proapoptotic protein Siva binds to the muscle protein telethonin in cardiomyocytes during coxsackieviral infection.
18330885 2008 Pyrin, product of the MEFV locus, interacts with the proapoptotic protein, Siva.
17965021 2007 The lysophosphatidic acid 2 receptor mediates down-regulation of Siva-1 to promote cell survival.
17653867 2007 The Siva protein is a novel intracellular ligand of the CD4 receptor that promotes HIV-1 envelope-induced apoptosis in T-lymphoid cells.
17348035 2007 Human papillomavirus-16 E7 interacts with Siva-1 and modulates apoptosis in HaCaT human immortalized keratinocytes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16683188 2006 The zinc containing pro-apoptotic protein siva interacts with the peroxisomal membrane protein pmp22.
16491128 2006 Siva-1 negatively regulates NF-kappaB activity: effect on T-cell receptor-mediated activation-induced cell death (AICD).
15958577 2005 Expression of Siva-1 protein or its putative amphipathic helical region enhances cisplatin-induced apoptosis in breast cancer cells: effect of elevated levels of BCL-2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15105421 2004 The proapoptotic gene SIVA is a direct transcriptional target for the tumor suppressors p53 and E2F1.
15034012 2004 Siva-1 and an alternative splice form lacking the death domain, Siva-2, similarly induce apoptosis in T lymphocytes via a caspase-dependent mitochondrial pathway.
14739602 2004 The Siva-1 putative amphipathic helical region (SAH) is sufficient to bind to BCL-XL and sensitize cells to UV radiation induced apoptosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12478477 2002 GITR interacts with the pro-apoptotic protein Siva and induces apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12011449 2002 Siva-1 binds to and inhibits BCL-X(L)-mediated protection against UV radiation-induced apoptosis.
11920585 2002 CD70/CD27 ligand, a member of the TNF family, is expressed in human brain tumors.
11601913 2001 The apoptotic capability of coxsackievirus B3 is influenced by the efficient interaction between the capsid protein VP2 and the proapoptotic host protein Siva.
11278261 2001 The ARG tyrosine kinase interacts with Siva-1 in the apoptotic response to oxidative stress.
10756043 2000 Apoptosis in coxsackievirus B3-caused diseases: interaction between the capsid protein VP2 and the proapoptotic protein siva.
9177220 1997 CD27, a member of the tumor necrosis factor receptor family, induces apoptosis and binds to Siva, a proapoptotic protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.