Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.19
PubTator Score 45.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 1.4e-29
interstitial cystitis 2299 1.4e-03
osteosarcoma 7933 1.6e-03
cutaneous lupus erythematosus 1056 8.3e-03

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 1.400 8.3e-03
osteosarcoma -1.451 1.6e-03
interstitial cystitis 1.400 1.4e-03
psoriasis 1.300 1.4e-29

Gene RIF (2)

PMID Text
21957439 SIT as an important modulator of TCR-mediated signaling that regulates T-cell activation, homeostasis and tolerance
19204726 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNQADPRLRAVCLWTLTSAAMSRGDNCTDLLALGIPSITQAWGLWVLLGAVTLLFLISLAAHLSQWTRGR      1 - 70
SRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIP     71 - 140
GPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS                  141 - 196
//

Text Mined References (20)

PMID Year Title
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
21957439 2011 The transmembrane adaptor protein SIT inhibits TCR-mediated signaling.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16160011 2006 Transmembrane adaptor molecules: a new category of lymphoid-cell markers.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15570572 2005 Automated immobilized metal affinity chromatography/nano-liquid chromatography/electrospray ionization mass spectrometry platform for profiling protein phosphorylation sites.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11491537 Complete sequence, genomic organization, and chromosomal localization of the human gene encoding the SHP2-interacting transmembrane adaptor protein (SIT).
11433379 2001 Structural and functional dissection of the cytoplasmic domain of the transmembrane adaptor protein SIT (SHP2-interacting transmembrane adaptor protein).
11390434 2001 The transmembrane adaptor protein TRIM regulates T cell receptor (TCR) expression and TCR-mediated signaling via an association with the TCR zeta chain.
10209036 1999 SHP2-interacting transmembrane adaptor protein (SIT), a novel disulfide-linked dimer regulating human T cell activation.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.