Property Summary

Ligand Count 1
NCBI Gene PubMed Count 133
PubMed Score 325.87
PubTator Score 130.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cardiomegaly 116 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 3.4e-10
glioblastoma 5792 1.7e-07
atypical teratoid / rhabdoid tumor 5112 2.6e-06
medulloblastoma, large-cell 6241 2.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.966 2.0
diabetes mellitus 1728 3.761 1.9
Obesity 678 3.375 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.6e-06
glioblastoma 1.500 1.7e-07
medulloblastoma, large-cell 1.400 2.5e-04
ovarian cancer 1.200 3.4e-10

Gene RIF (120)

AA Sequence

MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGV      1 - 70
WTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEE     71 - 140
CAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLS    141 - 210
ITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPR    211 - 280
VLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKA    281 - 350
KAVPS                                                                     351 - 355
//

Text Mined References (138)

PMID Year Title