Property Summary

Ligand Count 1
NCBI Gene PubMed Count 46
PubMed Score 219.31
PubTator Score 53.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.500 2.0e-04
astrocytic glioma -1.100 1.5e-02
Astrocytoma, Pilocytic -1.100 8.2e-04
atypical teratoid / rhabdoid tumor -1.500 8.1e-07
glioblastoma -1.100 2.2e-04
group 4 medulloblastoma -1.300 6.7e-04
lung cancer 1.200 4.0e-03
medulloblastoma, large-cell -1.800 4.1e-06
osteosarcoma -1.722 1.2e-06
primitive neuroectodermal tumor -1.200 2.1e-03

PDB (10)

Gene RIF (31)

AA Sequence

MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTF      1 - 70
RGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQ     71 - 140
NIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEA    141 - 210
GCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTP    211 - 280
ATNRFRFHFQGPCGTTLPEALACHENETVS                                            281 - 310
//

Text Mined References (53)

PMID Year Title