Property Summary

NCBI Gene PubMed Count 40
PubMed Score 198.82
PubTator Score 53.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.100 1.5e-02
osteosarcoma -3.580 3.0e-13
glioblastoma -1.800 4.0e-06
atypical teratoid / rhabdoid tumor -1.500 8.1e-07
medulloblastoma -1.400 1.3e-04
medulloblastoma, large-cell -1.800 4.1e-06
primitive neuroectodermal tumor -1.200 2.1e-03
lung cancer 1.200 4.0e-03
pediatric high grade glioma -1.500 1.2e-05
pilocytic astrocytoma -1.100 7.7e-04

Gene RIF (25)

PMID Text
27023330 mutual cooperation between Y102 and R105 residues in promoting the desuccinylation versus deacetylation reaction in SIRT5.
26001219 Use of a pan-sirtuin inhibitor and shRNA-mediated protein knockdown led us to uncover a role for the NAD(+)-dependent family of sirtuins, and in particular for SIRT2 and SIRT5, in the regulation of the necroptotic cell death program
25717114 Data showed that SIRT5 was involved in protein post-translational modifications through its potent demalonylase, desuccinylase, and deglutarylase activities. Also, the protein was found in the mitochondrial, cytoplasmic, and nuclear compartments. [review]
25361925 This study demonstrated that SIRT15 downregulation in the liver of non-alcoholic fatty liver disease patients.
25165814 Results show that mitochondrial sirtuins SIRT3, SIRT4, and SIRT5 can promote increased mitochondrial respiration and cellular metabolism and respond to excess glucose by inducing a coordinated increase of glycolysis and respiration.
25111069 The results reveal the Sirt5 substrate acyl selectivity and its molecular basis and enable the design of inhibitors for Sirt5.
25070488 High SIRT5 expression facilitates cancer cell growth and drug resistance in non-small cell lung cancer.
25032863 SIRT1/SIRT5-mediated PML deacetylation plays a role in the regulation of cancer cell survival.
24464653 Expression of SIRT5 in the entorhinal cortex, hippocampus, and white matter increases during the progression of Alzheimer disease. It is seen in activated microglia.
24140062 These results reveal a novel post-translational regulation of SOD1 by means of succinylation and SIRT5-dependent desuccinylation, which is important for the growth of lung tumor cells.
23978077 Results suggest a role for SIRT5 in influencing oocyte quality and in vitro fertilization outcomes.
23475622 Downregulation of SIRT5 is associated with head and neck squamous cell carcinoma.
23028781 Analysis of Sirt5 structures and activity data suggest that an Arg/succinate interaction is the molecular basis of the differential nicotinamide sensitivities of the two Sirt5 activities.
22767592 The bicyclic intermediate structure provides insights into the desuccinylation mechanism of human sirtuin 5 (SIRT5).
22585829 NAD(+)-dependent SIRT deacetylase has a role in regulating the expression of mitochondrial steroidogenic P450
22076378 study found that Sirt5 is an efficient protein lysine desuccinylase and demalonylase in vitro; protein lysine succinylation may represent a posttranslational modification that can be reversed by Sirt5 in vivo
21908771 we demonstrate that Sirt5, a member of the class III lysine deacetylases, can catalyze lysine demalonylation and lysine desuccinylation reactions both in vitro and in vivo
21143562 these results indicate that human SIRT5 potentially controls various primate-specific functions via two isoforms with different intracellular localizations or stabilities.
20887790 SIRT5 represents a risk factor for mitochondrial dysfunction-related diseases, including Parkinson's, through accelerated molecular aging of disease-related genes.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
18680753 Results describe the substrates and regulation mechanisms for the human mitochondrial sirtuins Sirt3 and Sirt5.
16827919 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
16827919 Analyses did not yield convincing evidence for associations of schizophrenia with SIRT5.
16484774 SIRT5 consists of eight exons and is found in two isoforms, which encode a 310 aa and a 299 aa protein, respectively.

AA Sequence

MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTF      1 - 70
RGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQ     71 - 140
NIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEA    141 - 210
GCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTP    211 - 280
ATNRFRFHFQGPCGTTLPEALACHENETVS                                            281 - 310
//

Text Mined References (46)

PMID Year Title
27023330 2016 Role of the Substrate Specificity-Defining Residues of Human SIRT5 in Modulating the Structural Stability and Inhibitory Features of the Enzyme.
26001219 2016 Intracellular nicotinamide adenine dinucleotide promotes TNF-induced necroptosis in a sirtuin-dependent manner.
25717114 2015 Metabolic Regulation by Lysine Malonylation, Succinylation, and Glutarylation.
25361925 2014 Direct evidence of sirtuin downregulation in the liver of non-alcoholic fatty liver disease patients.
25165814 2014 Overexpression of mitochondrial sirtuins alters glycolysis and mitochondrial function in HEK293 cells.
25111069 2014 Chemical probing of the human sirtuin 5 active site reveals its substrate acyl specificity and peptide-based inhibitors.
25070488 2014 SIRT5 facilitates cancer cell growth and drug resistance in non-small cell lung cancer.
25032863 2014 Deacetylation of the tumor suppressor protein PML regulates hydrogen peroxide-induced cell death.
24703693 2014 Lysine glutarylation is a protein posttranslational modification regulated by SIRT5.
24464653 2014 Distinct patterns of sirtuin expression during progression of Alzheimer's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24140062 2013 SIRT5 desuccinylates and activates SOD1 to eliminate ROS.
23978077 2014 Mitochondrial SIRT5 is present in follicular cells and is altered by reduced ovarian reserve and advanced maternal age.
23806337 2013 SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.
23475622 2013 Altered expression of SIRT gene family in head and neck squamous cell carcinoma.
23185430 2012 A molecular mechanism for direct sirtuin activation by resveratrol.
23028781 2012 Sirt5 deacylation activities show differential sensitivities to nicotinamide inhibition.
22849721 2012 Synthesis of carba-NAD and the structures of its ternary complexes with SIRT3 and SIRT5.
22767592 2012 The bicyclic intermediate structure provides insights into the desuccinylation mechanism of human sirtuin 5 (SIRT5).
22585829 2012 Resveratrol stimulates cortisol biosynthesis by activating SIRT-dependent deacetylation of P450scc.
22076378 2011 Sirt5 is a NAD-dependent protein lysine demalonylase and desuccinylase.
21908771 2011 The first identification of lysine malonylation substrates and its regulatory enzyme.
21269460 2011 Initial characterization of the human central proteome.
21143562 2011 Distinct regulation of mitochondrial localization and stability of two human Sirt5 isoforms.
20887790 2011 Brain molecular aging, promotion of neurological disease and modulation by sirtuin 5 longevity gene polymorphism.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
18680753 2008 Substrates and regulation mechanisms for the human mitochondrial sirtuins Sirt3 and Sirt5.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17456799 2007 Sirtuin functions in health and disease.
17355872 2007 Structural basis of inhibition of the human NAD+-dependent deacetylase SIRT5 by suramin.
16827919 2007 DNA pooling: a comprehensive, multi-stage association analysis of ACSL6 and SIRT5 polymorphisms in schizophrenia.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16484774 2006 Assignment of the NAD-dependent deacetylase sirtuin 5 gene (SIRT5) to human chromosome band 6p23 by in situ hybridization.
16381901 2006 The LIFEdb database in 2006.
16079181 2005 Evolutionarily conserved and nonconserved cellular localizations and functions of human SIRT proteins.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10873683 2000 Phylogenetic classification of prokaryotic and eukaryotic Sir2-like proteins.
10381378 1999 Characterization of five human cDNAs with homology to the yeast SIR2 gene: Sir2-like proteins (sirtuins) metabolize NAD and may have protein ADP-ribosyltransferase activity.