Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.80
PubTator Score 6.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
cutaneous lupus erythematosus 1.900 9.2e-03
osteosarcoma -3.278 3.7e-08
atypical teratoid / rhabdoid tumor 1.200 1.7e-03
medulloblastoma, large-cell 1.600 2.3e-04
tuberculosis 1.900 1.1e-05
diabetes mellitus 1.300 2.1e-03
interstitial cystitis 1.800 1.0e-03
adult high grade glioma 1.300 2.6e-04
invasive ductal carcinoma 1.200 2.2e-02
ovarian cancer 1.300 1.1e-09
psoriasis 1.700 4.1e-49

Gene RIF (5)

PMID Text
24162948 The independent non-obstructive azoospermia risk alleles are driven by variants in the protein-coding sequence of the two genes, SIRPA and SIRPG.
23826770 SIRPgamma in complex with FabOX117 forms a dimer in the crystal. Binding to the Fab fixes the position of domain 1 relative to domains 2/3 exposing a surface which favours formation of a homotypic dimer.
19473566 tumor necrosis factor receptor superfamily, member 14 (TNFRSF14) and signal regulatory protein, gamma (SIRPG) appear to contribute to gender difference in incidence of systemic lupus erythematosus.
18524990 CD47 is enriched at endothelial junctions, and its interaction with SIRPgamma is required for human T-cell transendothelial migration
15294972 a novel member of the signal regulatory protein (SIRP) family- with unique characteristics from both alpha and beta genes- termed SIRPgamma

AA Sequence

MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGV      1 - 70
GPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEM     71 - 140
ALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPTGQSVAYSIRST    141 - 210
ARVVLDPWDVRSQVICEVAHVTLQGDPLRGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYPQS    211 - 280
LQLTWSENGNVCQRETASTLTENKDGTYNWTSWFLVNISDQRDDVVLTCQVKHDGQLAVSKRLALEVTVH    281 - 350
QKDQSSDATPGPASSLTALLLIAVLLGPIYVPWKQKT                                     351 - 387
//

Text Mined References (18)

PMID Year Title
24162948 2014 Pathogenic variants screening in five non-obstructive azoospermia-associated genes.
23826770 2013 Crystal structure of signal regulatory protein gamma (SIRP?) in complex with an antibody Fab fragment.
19473566 Changes in the gene expression of peripheral blood mononuclear cells during the menstrual cycle of females is associated with a gender bias in the incidence of systemic lupus erythematosus.
19430480 2009 Genome-wide association study and meta-analysis find that over 40 loci affect risk of type 1 diabetes.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
18657508 2008 Paired receptor specificity explained by structures of signal regulatory proteins alone and complexed with CD47.
18524990 2008 Endothelial CD47 interaction with SIRPgamma is required for human T-cell transendothelial migration under shear flow conditions in vitro.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16691243 2006 The SIRP family of receptors and immune regulation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16339511 2005 A nomenclature for signal regulatory protein family members.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383453 2005 Adhesion of human T cells to antigen-presenting cells through SIRPbeta2-CD47 interaction costimulates T-cell proliferation.
15294972 2004 Human lymphocytes interact directly with CD47 through a novel member of the signal regulatory protein (SIRP) family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11185750 2000 Molecular cloning of a novel human gene (SIRP-B2) which encodes a new member of the SIRP/SHPS-1 protein family.
9062191 1997 A family of proteins that inhibit signalling through tyrosine kinase receptors.