Property Summary

NCBI Gene PubMed Count 7
PubMed Score 14.67
PubTator Score 0.98

Knowledge Summary


No data available


  Differential Expression (8)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.400 4.4e-03
oligodendroglioma -1.300 3.7e-02
osteosarcoma -1.083 8.8e-03
ovarian cancer -1.200 1.6e-06
pancreatic ductal adenocarcinoma liver m... -1.063 1.4e-02
pituitary cancer 1.400 3.5e-08
subependymal giant cell astrocytoma -1.019 1.8e-02
tuberculosis -1.200 1.5e-06


Accession Q8NDZ2 J3KQQ8 Q6NXN8 Q6ZTU4 Q8IZ15
Symbols OOMA1


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

LQDKVHLLKLLLFYAADLNPDAEPFQKGWSGS                                          841 - 872

Text Mined References (9)

PMID Year Title