Property Summary

NCBI Gene PubMed Count 7
PubMed Score 14.67
PubTator Score 0.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.400 4.4e-03
oligodendroglioma -1.300 3.7e-02
osteosarcoma -1.083 8.8e-03
ovarian cancer -1.200 1.6e-06
pancreatic ductal adenocarcinoma liver m... -1.063 1.4e-02
pituitary cancer 1.400 3.5e-08
subependymal giant cell astrocytoma -1.019 1.8e-02
tuberculosis -1.200 1.5e-06

Gene RIF (1)

AA Sequence

MAPASASGEDLRKLPTMAEVNGEQDFIDLTRETRPRTKDRSGLYVIDLTRAEGENRPIATLDLTLEPVTP      1 - 70
SQKEPTSLQTCASLSGKAVMEGHVDRSSQPTARRIINSDPVDLDLVEENTFVGPPPATSISGGSVYPTEP     71 - 140
NCSSATFTGNLSFLASLQLSSDVSSLSPTSNNSRSSSSSSNQKAPLPCPQQDVSRPPQALPCPLRPLPCP    141 - 210
PRASPCPPRASSCPPRALSCPSQTMQCQLPALTHPPQEVPCPRQNIPGPPQDSLGLPQDVPGLPQSILHP    211 - 280
QDVAYLQDMPRSPGDVPQSPSDVSPSPDAPQSPGGMPHLPGDVLHSPGDMPHSSGDVTHSPRDIPHLPGD    281 - 350
RPDFTQNDVQNRDMPMDISALSSPSCSPSPQSETPLEKVPWLSVMETPARKEISLSEPAKPGSAHVQSRT    351 - 420
PQGGLYNRPCLHRLKYFLRPPVHHLFFQTLIPDKDTRENKGQKLEPIPHRRLRMVTNTIEENFPLGTVQF    421 - 490
LMDFVSPQHYPPREIVAHIIQKILLSGSETVDVLKEAYMLLMKIQQLHPANAKTVEWDWKLLTYVMEEEG    491 - 560
QTLPGRVLFLRYVVQTLEDDFQQTLRRQRQHLQQSIANMVLSCDKQPHNVRDVIKWLVKAVTEDGLTQPP    561 - 630
NGNQTSSGTGILKASSSHPSSQPNLTKNTNQLIVCQLQRMLSIAVEVDRTPTCSSNKIAEMMFGFVLDIP    631 - 700
ERSQREMFFTTMESHLLRCKVLEIIFLHSCETPTRLPLSLAQALYFLNNSTSLLKCQSDKSQWQTWDELV    701 - 770
EHLQFLLSSYQHVLREHLRSSVIDRKDLIIKRIKPKPQQGDDITVVDVEKQIEAFRSRLIQMLGEPLVPQ    771 - 840
LQDKVHLLKLLLFYAADLNPDAEPFQKGWSGS                                          841 - 872
//

Text Mined References (9)

PMID Year Title