Property Summary

NCBI Gene PubMed Count 43
PubMed Score 78.96
PubTator Score 71.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.800 5.6e-04
atypical teratoid / rhabdoid tumor 2.100 2.1e-02
Breast cancer 1.500 1.2e-03
colon cancer 2.500 5.4e-03
cutaneous lupus erythematosus -1.300 8.9e-03
glioblastoma 1.200 1.1e-02
intraductal papillary-mucinous carcinoma... 1.100 4.7e-02
intraductal papillary-mucinous neoplasm ... 1.400 1.5e-03
malignant mesothelioma 4.200 7.3e-10
osteosarcoma 1.089 1.7e-03
psoriasis -2.000 1.4e-03
spina bifida -1.281 2.3e-02
urothelial carcinoma 2.000 8.3e-03

Gene RIF (23)

AA Sequence

MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGLGDAWGQPSRA      1 - 70
GPLDGVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELTGNSIYEYIHPSDHDEMTAVL     71 - 140
TAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGYKVIHCSGYLKIRQYMLDMSLYDSCYQIVGL    141 - 210
VAVGQSLPPSAITEIKLYSNMFMFRASLDLKLIFLDSRVTEVTGYEPQDLIEKTLYHHVHGCDVFHLRYA    211 - 280
HHLLLVKGQVTTKYYRLLSKRGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTEIEYKELQLSLEQVSTA    281 - 350
KSQDSWRTALSTSQETRKLVKPKNTKMKTKLRTNPYPPQQYSSFQMDKLECGQLGNWRASPPASAAAPPE    351 - 420
LQPHSESSDLLYTPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFLSTLPASGECQ    421 - 490
WHYANPLVPSSSSPAKNPPEPPANTARHSLVPSYEAPAAAVRRFGEDTAPPSFPSCGHYREEPALGPAKA    491 - 560
ARQAARDGARLALARAAPECCAPPTPEAPGAPAQLPFVLLNYHRVLARRGPLGGAAPAASGLACAPGGPE    561 - 630
AATGALRLRHPSPAATSPPGAPLPHYLGASVIITNGR                                     631 - 667
//

Text Mined References (45)

PMID Year Title