Property Summary

NCBI Gene PubMed Count 41
PubMed Score 75.80
PubTator Score 71.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
urothelial carcinoma 2.200 4.3e-02
malignant mesothelioma 4.200 7.3e-10
cutaneous lupus erythematosus -1.300 8.9e-03
psoriasis -2.000 1.4e-03
osteosarcoma 1.089 1.7e-03
glioblastoma 1.200 1.1e-02
atypical teratoid / rhabdoid tumor 2.700 1.6e-02
intraductal papillary-mucinous carcinoma... 1.100 4.7e-02
intraductal papillary-mucinous neoplasm ... 2.100 2.2e-03
colon cancer 2.700 3.1e-04
adult high grade glioma 1.800 5.6e-04
spina bifida -2.289 3.1e-02
Breast cancer 1.500 1.2e-03

Gene RIF (22)

PMID Text
25319570 In SH-SY5Y cells, ethanol exposure increased Sim2 expression in a manner similar to that of cleaved caspase 3. PKA activation was required for this. Sim2 might be involved in activating caspase 3 and ethanol-induced apoptosis in SH-SY5Y cells.
24909296 Data showed that SIM2 was highly expressed in human glioma tumors and cell lines and its short form might increase the invasion of glioma cells through the alteration of epithelial-mesenchymal transition.
24814368 Data suggest selected SIM1 variants exhibit poor dimerization with ARNT2 (aryl-hydrocarbon receptor nuclear translocator 2) and anomalous intracellular localization; data were used to predict spot in SIM1/SIM2 (residues 290-326) critical in function.
24690990 a single peptide containing multiple SIM2 epitopes can be used to induce both a CD4 and CD8 T cell response, providing a peptide-based vaccine formulation for potential use in immunotherapy of various cancers.
24162743 miR-200a is downregulated in human glioma and inhibition of miR-200a caused upregulation of SIM2-s in T98G cells and promoted their motility.
23343470 Altered expression of SIM2 and ETS2 could be one of the reasons for variable occurrence of different malignant conditions in Down syndrome.
22777354 role for SIM2s in promoting human breast tumor differentiation and maintaining epithelial integrity.
22174909 These results suggest an involvement of SIM2 in key traits of prostate tumor cell biology.
22048266 Significantly lower frequency of SIM2 C-G haplotype (rs2073601-rs2073416) was noticed in individuals with Down syndrome (P value =0.01669) and their fathers (P value=0.01185)
20137643 Genetic variants of SIM2 gene may not be associated with the susceptibility to congenital scoliosis and different clinical phenotypes of CS in Chinese Han population.
19737960 The SIM2 is expressed in prostate cancer(PCa) and that anti-SIM2 antibodies are detectable in PCa patients' sera implicate SIM2 as a PCa-associated antigen that is a suitable potential target for PCa immunotherapy.
19668230 SIM2s' functional interference with HIF1alpha activities on BNIP3 may indicate a novel role for SIM2s in promoting tumourigenesis.
19169276 Ha-Ras transformation of MCF10A cells leads to repression of Singleminded-2s through NOTCH and C/EBPbeta.
18160708 Knockdown of SIM2s in MCF-7 breast cancer cells contributed to an epithelial-mesenchymal transition associated with increased MMP2 and slug levels.
16840439 The expression of a splice variant of SIM2, SIM2s, is lost or reduced in human breast cancers. Inhibits growth and invasiveness of breast cancer cells upon ectopic expression. Represses MMP3 expression by direct binding to the MMP3 promoter.
16129820 provide a direct link between SIM2-s and differentiation, and may provide a model to identify SIM2-s targets
15946822 Potential role of SIM2 in central nervous system development. SIM2 overexpression could participate in pathogenesis of mental retardation in Down syndrome.
14701734 a novel NXF signaling system on neural gene promoter may be a molecular target of the adverse effects of Sim2 in the mental retardation of Down's syndrome
14697214 SIM1 and SIM2 have a novel nuclear localization signal
14550949 Tissue- and tumor-specific expression of both SIM2 isoforms (SIM2-s and SIM2-l), but not SIM1, were detected in the pancreatic tumor models.
12676991 Isoform-specific expression of SIM2 short-form (SIM2-s) was seen selectively in colon, prostate, and pancreatic carcinomas.
12530058 Stage-specific expression of the sim2-short-form protein was seen in normal matched paraffin sections of the colon tumors. In a matched set of tissues of Benign Prostatic Hyperplasia (BPH) and prostate carcinomas, sim2-s expression was detected in the BPH

AA Sequence

MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGLGDAWGQPSRA      1 - 70
GPLDGVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELTGNSIYEYIHPSDHDEMTAVL     71 - 140
TAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGYKVIHCSGYLKIRQYMLDMSLYDSCYQIVGL    141 - 210
VAVGQSLPPSAITEIKLYSNMFMFRASLDLKLIFLDSRVTEVTGYEPQDLIEKTLYHHVHGCDVFHLRYA    211 - 280
HHLLLVKGQVTTKYYRLLSKRGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTEIEYKELQLSLEQVSTA    281 - 350
KSQDSWRTALSTSQETRKLVKPKNTKMKTKLRTNPYPPQQYSSFQMDKLECGQLGNWRASPPASAAAPPE    351 - 420
LQPHSESSDLLYTPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFLSTLPASGECQ    421 - 490
WHYANPLVPSSSSPAKNPPEPPANTARHSLVPSYEAPAAAVRRFGEDTAPPSFPSCGHYREEPALGPAKA    491 - 560
ARQAARDGARLALARAAPECCAPPTPEAPGAPAQLPFVLLNYHRVLARRGPLGGAAPAASGLACAPGGPE    561 - 630
AATGALRLRHPSPAATSPPGAPLPHYLGASVIITNGR                                     631 - 667
//

Text Mined References (43)

PMID Year Title
25319570 2015 Ethanol Activation of PKA Mediates Single-Minded 2 Expression in Neuronal Cells.
24909296 2014 Targeting SIM2-s decreases glioma cell invasion through mesenchymal--epithelial transition.
24814368 2014 Characterization of human variants in obesity-related SIM1 protein identifies a hot-spot for dimerization with the partner protein ARNT2.
24690990 2014 Immunization with a peptide containing MHC class I and II epitopes derived from the tumor antigen SIM2 induces an effective CD4 and CD8 T-cell response.
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
24162743 2014 MiR-200a impairs glioma cell growth, migration, and invasion by targeting SIM2-s.
23343470 2013 Potential contribution of SIM2 and ETS2 functional polymorphisms in Down syndrome associated malignancies.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22777354 2013 Regulation of DCIS to invasive breast cancer progression by Singleminded-2s (SIM2s).
22174909 2011 The role of the transcription factor SIM2 in prostate cancer.
22048266 2011 Exploratory investigation on functional significance of ETS2 and SIM2 genes in Down syndrome.
20448453 2010 Single minded 2-s (SIM2-s) gene is expressed in human GBM cells and involved in GBM invasion.
20137643 2009 [Association study of SIM2 gene polymorphisms with susceptibility to congenital scoliosis in a Chinese Han population].
19737960 2009 Identification of the transcription factor single-minded homologue 2 as a potential biomarker and immunotherapy target in prostate cancer.
19668230 2009 The HIF1alpha-inducible pro-cell death gene BNIP3 is a novel target of SIM2s repression through cross-talk on the hypoxia response element.
19169276 2009 Ha-Ras transformation of MCF10A cells leads to repression of Singleminded-2s through NOTCH and C/EBPbeta.
18160708 2008 Loss of singleminded-2s in the mouse mammary gland induces an epithelial-mesenchymal transition associated with up-regulation of slug and matrix metalloprotease 2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16840439 2007 Inhibition of breast cancer growth and invasion by single-minded 2s.
16129820 2005 Inhibition of Single Minded 2 gene expression mediates tumor-selective apoptosis and differentiation in human colon cancer cells.
15963499 2005 Transcription factor single-minded 2 (SIM2) is ubiquitinated by the RING-IBR-RING-type E3 ubiquitin ligases.
15946822 2005 Spatial and temporal localization during embryonic and fetal human development of the transcription factor SIM2 in brain regions altered in Down syndrome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14701734 2004 Identification of a novel basic helix-loop-helix-PAS factor, NXF, reveals a Sim2 competitive, positive regulatory role in dendritic-cytoskeleton modulator drebrin gene expression.
14697214 2004 A novel nuclear localization signal in the human single-minded proteins SIM1 and SIM2.
14550949 2003 Down's syndrome-associated Single Minded 2 gene as a pancreatic cancer drug therapy target.
12676991 2003 Identification of Down's syndrome critical locus gene SIM2-s as a drug therapy target for solid tumors.
12530058 Down's syndrome-associated single minded gene as a novel tumor marker.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11782478 2002 Differential activities of murine single minded 1 (SIM1) and SIM2 on a hypoxic response element. Cross-talk between basic helix-loop-helix/per-Arnt-Sim homology transcription factors.
11404025 2001 Molecular mechanisms of human single-minded 2 (SIM2) gene expression: identification of a promoter site in the SIM2 genomic sequence.
10830953 2000 The DNA sequence of human chromosome 21.
10400987 1999 Mild impairment of learning and memory in mice overexpressing the mSim2 gene located on chromosome 16: an animal model of Down's syndrome.
9503011 1998 Transcriptional map of the 2.5-Mb CBR-ERG region of chromosome 21 involved in Down syndrome.
9271372 1997 The murine Sim-2 gene product inhibits transcription by active repression and functional interference.
9199934 1997 Cloning of two human homologs of the Drosophila single-minded gene SIM1 on chromosome 6q and SIM2 on 21q within the Down syndrome chromosomal region.
9020169 1997 Two murine homologs of the Drosophila single-minded protein that interact with the mouse aryl hydrocarbon receptor nuclear translocator protein.
8905236 1996 A 19-kb CpG island associated with single-minded gene 2 in Down syndrome chromosomal region.
8812055 1996 Expression patterns of two murine homologs of Drosophila single-minded suggest possible roles in embryonic patterning and in the pathogenesis of Down syndrome.
8661114 1996 The mammalian single-minded (SIM) gene: mouse cDNA structure and diencephalic expression indicate a candidate gene for Down syndrome.
7647800 1995 Single-minded and Down syndrome?
7568099 1995 Down syndrome-critical region contains a gene homologous to Drosophila sim expressed during rat and human central nervous system development.
7485157 1995 Physical mapping of the holoprosencephaly critical region in 21q22.3, exclusion of SIM2 as a candidate gene for holoprosencephaly, and mapping of SIM2 to a region of chromosome 21 important for Down syndrome.