Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.66
PubTator Score 3.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.1e-03
Breast cancer 3.000 2.7e-02
glioblastoma 1.100 3.0e-03
group 4 medulloblastoma 1.600 3.5e-04
intraductal papillary-mucinous adenoma (... 1.300 4.5e-04
intraductal papillary-mucinous carcinoma... 1.200 1.9e-03
medulloblastoma, large-cell 1.800 6.3e-05
osteosarcoma 1.891 1.3e-04
ovarian cancer 1.700 2.0e-04
psoriasis -2.800 7.3e-05

Gene RIF (2)

AA Sequence

MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQYQEDASDMKDMSKYKPH      1 - 70
ILLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAKKAVDAEPVLKAHQSHSAEIES     71 - 140
QIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISSESLQARKENSMDTASQAIK       141 - 207
//

Text Mined References (13)

PMID Year Title