Property Summary

NCBI Gene PubMed Count 22
PubMed Score 630.17
PubTator Score 59.27

Knowledge Summary

Patent (13,099)

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy -2.800 7.5e-05

 GO Component (2)

Protein-protein Interaction (5)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (15)

PMID Text
26719072 the results showed that miR-203 promotes proliferation, migration and invasion in pancreatic cancer cells, whereas the restoration of SIK1 abrogated the regulation of pre-miR203-mediated proliferation, migration and invasion.
25839329 De novo mutations in SIK1 cause a spectrum of developmental epilepsies.
25384047 Results show a role of SIK1 in gastrin induced responses and suggest that SIK1 may act as tumour suppressor in gastric adenocarcinoma cells.
23577667 These findings revealed a new function of LKB1 and salt-inducible kinases as negative regulators of HTLV-1 transcription.
23256157 SIK1 is required for myogenic differentiation; it's transcriptional regulation and regulated degradation comprise a unified molecular mechanism to precisely tune SIK1 activity in muscle cells.
22395973 High SIK gene expression is assiciated with glioblastoma multiforme.
22378783 We now demonstrate that TGFbeta induces SIK1 levels via a direct transcriptional mechanism that implicates the Smad proteins, and we have mapped a putative enhancer element on the SIK1 gene.
21549091 These results provide evidence that SIK1 is present in lung epithelial cells and that its function is relevant for the action of isoproterenol during regulation of active sodium transport.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20223287 activation of the RhoA-ROCK-p38MAPK-MSK signaling pathway is essential for the regulation of the phenotype and of the CST5/cystatin D candidate tumor suppressor and other target genes by 1,25(OH)2D3 in colon cancer cells
19622832 SIK1 links LKB1 to p53-dependent anoikis and suppresses metastasis.
18976975 Knockdown of salt-inducible kinase 1 (SIK1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18725536 SIK is a negative regulator that controls TGFbeta receptor turnover and physiological signaling.
17939993 part of a cell sodium-sensing network controlling active sodium transport
17565599 the basic leucine zipper domain has a role in the regulation of transcriptional activity of CREB with TORC and salt inducible kinase [review]

AA Sequence

MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDKTRLDSSNLEK      1 - 70
IYREVQLMKLLNHPHIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGHLSENEARKKFWQILSAVEYC     71 - 140
HDHHIVHRDLKTENLLLDGNMDIKLADFGFGNFYKSGEPLSTWCGSPPYAAPEVFEGKEYEGPQLDIWSL    141 - 210
GVVLYVLVCGSLPFDGPNLPTLRQRVLEGRFRIPFFMSQDCESLIRRMLVVDPARRITIAQIRQHRWMRA    211 - 280
EPCLPGPACPAFSAHSYTSNLGDYDEQALGIMQTLGVDRQRTVESLQNSSYNHFAAIYYLLLERLKEYRN    281 - 350
AQCARPGPARQPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQWPLFFP    351 - 420
VDASCSGVFRPRPVSPSSLLDTAISEEARQGPGLEEEQDTQESLPSSTGRRHTLAEVSTRLSPLTAPCIV    421 - 490
VSPSTTASPAEGTSSDSCLTFSASKSPAGLSGTPATQGLLGACSPVRLASPFLGSQSATPVLQAQGGLGG    491 - 560
AVLLPVSFQEGRRASDTSLTQGLKAFRQQLRKTTRTKGFLGLNKIKGLARQVCQAPASRASRGGLSPFHA    561 - 630
PAQSPGLHGGAAGSREGWSLLEEVLEQQRLLQLQHHPAAAPGCSQAPQPAPAPFVIAPCDGPGAAPLPST    631 - 700
LLTSGLPLLPPPLLQTGASPVASAAQLLDTHLHIGTGPTALPAVPPPRLARLAPGCEPLGLLQGDCEMED    701 - 770
LMPCSLGTFVLVQ                                                             771 - 783
//

Text Mined References (25)

PMID Year Title
26719072 2016 miR-203 promotes proliferation, migration and invasion by degrading SIK1 in pancreatic cancer.
25839329 2015 De novo mutations in SIK1 cause a spectrum of developmental epilepsies.
25384047 2014 Salt-inducible kinase 1 (SIK1) is induced by gastrin and inhibits migration of gastric adenocarcinoma cells.
23577667 2013 LKB1 tumor suppressor and salt-inducible kinases negatively regulate human T-cell leukemia virus type 1 transcription.
23256157 2013 Regulation of SIK1 abundance and stability is critical for myogenesis.
22395973 2012 Integration of global spectral karyotyping, CGH arrays, and expression arrays reveals important genes in the pathogenesis of glioblastoma multiforme.
22378783 2012 Transcriptional induction of salt-inducible kinase 1 by transforming growth factor ? leads to negative regulation of type I receptor signaling in cooperation with the Smurf2 ubiquitin ligase.
21549091 2011 Salt-inducible kinase 1 is present in lung alveolar epithelial cells and regulates active sodium transport.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20223287 2010 The effects of 1,25-dihydroxyvitamin D3 on colon cancer cells depend on RhoA-ROCK-p38MAPK-MSK signaling.
19622832 2009 SIK1 couples LKB1 to p53-dependent anoikis and suppresses metastasis.
18725536 2008 TGFbeta induces SIK to negatively regulate type I receptor kinase signaling.
18348280 2008 Importance of autophosphorylation at Ser186 in the A-loop of salt inducible kinase 1 for its sustained kinase activity.
17939993 2007 SIK1 is part of a cell sodium-sensing network that regulates active sodium transport through a calcium-dependent process.
17565599 2007 TORC-SIK cascade regulates CREB activity through the basic leucine zipper domain.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16306228 2005 14-3-3 cooperates with LKB1 to regulate the activity and localization of QSK and SIK.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14976552 2004 LKB1 is a master kinase that activates 13 kinases of the AMPK subfamily, including MARK/PAR-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10830953 2000 The DNA sequence of human chromosome 21.
9920726 1999 Molecular cloning and characterization of mammalian homologues of vesicle-associated membrane protein-associated (VAMP-associated) proteins.
7893599 1994 Identification of novel protein kinases expressed in the myocardium of the developing mouse heart.