Property Summary

NCBI Gene PubMed Count 81
PubMed Score 177.50
PubTator Score 84.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell 1.300 0.002
pancreatic ductal adenocarcinoma liver m... -2.013 0.000
lung cancer 2.200 0.000
colon cancer 1.600 0.003
ovarian cancer 1.400 0.000

Synonym

Accession Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0
Symbols SRBP
ALS16
DSMA2
OPRS1
SR-BP
SIG-1R
SR-BP1
sigma1R
hSigmaR1

Gene

PDB

5HK1   5HK2  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity

Gene RIF (72)

PMID Text
27042935 crystal structures of the human sigma1 receptor in complex with two chemically divergent ligands, PD144418 and 4-IBP
26792723 Collectively, these studies define Sig1R as a key mediator of TRAIL induction of cancer-specific killing.
26078401 Homozygous c.151+1G>T mutation in SIGMAR1 caused a novel form of autosomal recessive distal hereditary motor neuropathy (dHMN) in a Chinese consanguineous family; endoplasmic reticulum stress may have a role in the pathogenesis of dHMN
25902777 Central and peripheral pharmacological blockade of Sig-1R could be an effective option to treat inflammatory pain--{REVIEW}
25704016 Expression of mutant Sig-1R protein reduces mitochondrial ATP production, inhibits proteasome activity and causes mitochondrial injury, aggravating ER stress-induced neuronal death.
25704015 mutations of the SIGMAR1 gene worsen outcome in Alzheimer's disease and myotrophic lateral sclerosis supporting a role of Sig-1R in neurodegenerative disease.
25704014 overview of the biological mechanisms frequently associated with neurodegeneration, and discuss how sigma-1 receptors may alter these mechanisms to preserve or restore neuronal function.
25704013 Removal of the S1R gene in the Superoxide Dismutase-1 (SOD-1) mouse model of ALS exacerbated the neurodegenerative condition and resulted in a significantly reduced longevity.
25704011 Recent studies indicate that sigma-1 receptors, partly in sake of its unique subcellular localization, regulate the mitochondria function that involves bioenergetics and free radical generation.
25569182 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
More...

AA Sequence

MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHP      1 - 70
GHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGT     71 - 140
TKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGL    141 - 210
RLELTTYLFGQDP                                                             211 - 223
//

Text Mined References (85)

PMID Year Title
27042935 2016 Crystal structure of the human ?1 receptor.
26792723 2016 Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) activates caspases in human prostate cancer cells through sigma 1 receptor.
26078401 2015 A SIGMAR1 splice-site mutation causes distal hereditary motor neuropathy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25902777 2015 Sigma-1 receptor and inflammatory pain.
25704016 2015 The role of SIGMAR1 gene mutation and mitochondrial dysfunction in amyotrophic lateral sclerosis.
25704015 2015 The involvement of the sigma-1 receptor in neurodegeneration and neurorestoration.
25704014 2015 Role of sigma-1 receptors in neurodegenerative diseases.
25704013 2015 Role of the Sigma-1 receptor in Amyotrophic Lateral Sclerosis (ALS).
25704011 2015 Sigma-1 receptor: the novel intracellular target of neuropsychotherapeutic drugs.
More...