Property Summary

NCBI Gene PubMed Count 37
PubMed Score 44.21
PubTator Score 39.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

 GO Function (1)

Gene RIF (29)

AA Sequence

MLLLLLPLLWGRERAEGQTSKLLTMQSSVTVQEGLCVHVPCSFSYPSHGWIYPGPVVHGYWFREGANTDQ      1 - 70
DAPVATNNPARAVWEETRDRFHLLGDPHTKNCTLSIRDARRSDAGRYFFRMEKGSIKWNYKHHRLSVNVT     71 - 140
ALTHRPNILIPGTLESGCPQNLTCSVPWACEQGTPPMISWIGTSVSPLDPSTTRSSVLTLIPQPQDHGTS    141 - 210
LTCQVTFPGASVTTNKTVHLNVSYPPQNLTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSN    211 - 280
PPARLSLSWRGLTLCPSQPSNPGVLELPWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVV    281 - 350
GGAGATALVFLSFCVIFVVVRSCRKKSARPAAGVGDTGIEDANAVRGSASQGPLTEPWAEDSPPDQPPPA    351 - 420
SARSSVGEGELQYASLSFQMVKPWDSRGQEATDTEYSEIKIHR                               421 - 463
//

Text Mined References (39)

PMID Year Title