Property Summary

NCBI Gene PubMed Count 26
PubMed Score 36.08
PubTator Score 40.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7933 1.5e-05
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Asthma 349 3.826 1.9
Eosinophilic esophagitis 31 3.085 1.5
Common cold 63 3.0 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.340 1.5e-05

Gene RIF (19)

PMID Text
26694037 Ligands for Siglec-8 and Siglec-9 may regulate the function of eosinophils, mast cells, neutrophils, and other cells in sinus mucosa.
25747723 Inflammation results in up-regulation of immuneinhibitory Siglec-8 and Siglec-9 sialoglycan ligands on human airways.
23835953 Siglec-8 expression is sensitive to tiotropium and formoterol, indicating that it may be involved in COPD pathogenesis and may influence COPD phenotyping
23684072 In activated eosinophils ligation of Siglec-8 leads to ROS-dependent enhancement of IL-5-induced ERK phosphorylation, which results in a novel mode of biochemically regulated eosinophil cell death.
22683541 Report the development of a sensitive competitive ELISA to detect sSiglec-8 in human serum samples obtained from patients with various forms of eosinophilia.
22324980 Engagement of Siglec-8 on blood eosinophils results in caspase- and mitochondria-dependent apoptosis.
22079334 Eosinophils primed by IL-33 and/or IL-5 in vivo would be expected to display enhanced susceptibility to undergoing Siglec-8-induced apoptosis.
21938510 expressed on eosinophils and basophils from subjects with chronic eosinophilic leukemia, chronic myelogenous leukemia, and on malignant and non-malignant bone marrow mast cells
20237496 Observational study of gene-disease association. (HuGE Navigator)
20087405 The Siglec-8 gene may be a susceptibility locus for asthma.
20087405 Observational study of gene-disease association. (HuGE Navigator)
19458105 Selective and specific engagement and binding of Siglec-8 on eosinophils by a synthetic 6'-sulfo-sLe(x)-containing ligand could be useful for controlling eosinophilic inflammatory responses in vivo.
19178537 REVIEW: Siglec-8 and Siglec-F function on human eosinophils, and Siglec-8 function on mast cells
18558361 A review of the cytotoxic effects of natural anti-Siglec8 autoantibodies on both neutrophils and eosinophils.
18036650 First reported inhibitory effects of Siglec engagement on human mast cells.
17690326 IL-5 priming enhances Siglec-8-mediated mitochondrial and ROS-dependent eosinophil apoptosis and eliminates caspase dependence.
16157303 Siglec-8-induced apoptosis in eosinophils occurs through the sequential production of reactive oxygen species, followed by induction of mitochondrial injury and caspase cleavage.
15563466 Siglec-8 binds preferentially to a sLex structure bearing an additional sulfate ester on the galactose 6-hydroxyl
12609831 Sialic acid binding immunoglobulin-like lectin 8 (Siglec-8) cross-linking with antibodies rapidly generated caspase-3-like activity and reduced eosinophil viability through induction of apoptosis

AA Sequence

MLLLLLLLPLLWGTKGMEGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSDPVHGYWFRAG      1 - 70
DRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLN     71 - 140
YKTKQLSVFVTALTHRPDILILGTLESGHSRNLTCSVPWACKQGTPPMISWIGASVSSPGPTTARSSVLT    141 - 210
LTPKPQDHGTSLTCQVTLPGTGVTTTSTVRLDVSYPPWNLTMTVFQGDATASTALGNGSSLSVLEGQSLR    211 - 280
LVCAVNSNPPARLSWTRGSLTLCPSRSSNPGLLELPRVHVRDEGEFTCRAQNAQGSQHISLSLSLQNEGT    281 - 350
GTSRPVSQVTLAAVGGAGATALAFLSFCIIFIIVRSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLTE    351 - 420
SWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSEYSEIKIHKRETAETQACLRNH    421 - 490
NPSSKEVRG                                                                 491 - 499
//

Text Mined References (27)

PMID Year Title
26694037 2016 Regulation of airway inflammation by Siglec-8 and Siglec-9 sialoglycan ligand expression.
25747723 2015 Expression of ligands for Siglec-8 and Siglec-9 in human airways and airway cells.
23835953 2013 Siglec-8 in induced sputum of COPD patients.
23684072 2013 Mechanism of Siglec-8-mediated cell death in IL-5-activated eosinophils: role for reactive oxygen species-enhanced MEK/ERK activation.
22683541 2012 Biomarkers of eosinophil involvement in allergic and eosinophilic diseases: review of phenotypic and serum markers including a novel assay to quantify levels of soluble Siglec-8.
22324980 2012 Siglec-8 and Siglec-F, the new therapeutic targets in asthma.
22079334 2012 IL-33 enhances Siglec-8 mediated apoptosis of human eosinophils.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21938510 2011 Developmental, malignancy-related, and cross-species analysis of eosinophil, mast cell, and basophil siglec-8 expression.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20087405 2010 Polymorphisms in the sialic acid-binding immunoglobulin-like lectin-8 (Siglec-8) gene are associated with susceptibility to asthma.
19458105 2009 Eosinophil-selective binding and proapoptotic effect in vitro of a synthetic Siglec-8 ligand, polymeric 6'-sulfated sialyl Lewis x.
19178537 2009 Siglec-8 on human eosinophils and mast cells, and Siglec-F on murine eosinophils, are functionally related inhibitory receptors.
18558361 2008 Natural anti-Siglec autoantibodies mediate potential immunoregulatory mechanisms: implications for the clinical use of intravenous immunoglobulins (IVIg).
18036650 2008 Inhibition of FcepsilonRI-dependent mediator release and calcium flux from human mast cells by sialic acid-binding immunoglobulin-like lectin 8 engagement.
17690326 2008 Interleukin-5 priming of human eosinophils alters siglec-8 mediated apoptosis pathways.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16157303 2005 Mechanism of Siglec-8-induced human eosinophil apoptosis: role of caspases and mitochondrial injury.
15563466 2005 Glycan array screening reveals a candidate ligand for Siglec-8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12609831 2003 Ligation of Siglec-8: a selective mechanism for induction of human eosinophil apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11284738 2001 Identification, characterization and leucocyte expression of Siglec-10, a novel human sialic acid-binding receptor.
11095983 2000 Molecular characterization of a Siglec8 variant containing cytoplasmic tyrosine-based motifs, and mapping of the Siglec8 gene.
10856141 2000 Identification of SAF-2, a novel siglec expressed on eosinophils, mast cells, and basophils.
10625619 2000 Siglec-8. A novel eosinophil-specific member of the immunoglobulin superfamily.