Property Summary

NCBI Gene PubMed Count 28
PubMed Score 46.07
PubTator Score 56.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 3.7e-02
osteosarcoma -2.104 1.1e-04
tuberculosis 2.200 8.8e-08
interstitial cystitis 1.200 5.5e-03
mucosa-associated lymphoid tissue lympho... 1.804 4.8e-02
psoriasis 1.400 1.4e-18

Gene RIF (19)

PMID Text
24810846 Siglec-7 plays a significant role in inhibiting IgE-mediated mast cell activation, but only moderately affects IgE-mediated activation in primary human basophils.
24569453 Expression of Siglec-7 and -9 ligands was associated with susceptibility of NK cell-sensitive tumor cells and, unexpectedly, of presumably NK cell-resistant tumor cells to NK cell-mediated cytotoxicity.
24330394 These results show that Siglec-7 binds HIV-1 via gp120 and contributes to enhance the susceptibility to infection of CD4 positive T cells and monocyte-derived macrophages.
24330394 SIGLEC7 binds to HIV-1 gp120 and enhances HIV-1 infection of CD4+ T cells
23029261 Siglec-7 participates in generating a monocyte-mediated inflammatory outcome following pathogen recognition.
22933622 Based on upregulated SIGLEC7 expression in blood monocytes during relapse, findings suggest a role for SIGLEC7 in acute disease activity in multiple sclerosis.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19710502 The decreased expression of Siglec-7 represents an early marker of dysfunctional natural killer-cell subsets associated with high levels of HIV-1 viremia.
18331725 The species-specific differences in the expression expression of Siglecs in SIV infection was studied.
16828866 The expression levels of Siglec-7 were detectable in bone marrow plasma from AML patients and serum from normal donors.
16732727 Siglecs-7 did not interact with sulfate derivatives of LacNAc and sulfated oligosaccharides containing sialic acid.
16623661 structural analysis of siglec-7 in complex with sialosides
15703304 upon pervanadate (PV) treatment, Siglec-7 recruited the protein tyrosine phosphatases Src homology-2 (SH2) domain-containing protein-tyrosine phosphatase-1 and SHP-2 less efficiently than did other inhibitory receptors
15557178 Siglec-7 can inhibit Fc epsilon receptor I-mediated serotonin release from rat basophilic leukemia cells and recruit the tyrosine phosphatases SHP-1 and SHP-2.
15292262 Siglec-7 and Siglec-9 are capable of negative regulation of TCR signaling and ligand binding is required for optimal activity
14747738 x-ray crystallographic analysis of the saccharide-binding domain of p75/AIRM1
12778482 Sialidase unmasking of siglec-7 on NK cells permits it to interact with GD3 on target cells and inhibit killing. This has inplications for tumor escape from NK cells.
12438315 high resolution crystal structures of this protein; insights into ligand specificity of this family of proteins
11774609 Regulation of myeloid cell proliferation and survival by p75/AIRM1 and CD33 surface receptors.

AA Sequence

MLLLLLLPLLWGRERVEGQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDPVHGYWFRAGN      1 - 70
DISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLS     71 - 140
VNVTALTHRPNILIPGTLESGCFQNLTCSVPWACEQGTPPMISWMGTSVSPLHPSTTRSSVLTLIPQPQH    141 - 210
HGTSLTCQVTLPGAGVTTNRTIQLNVSYPPQNLTVTVFQGEGTASTALGNSSSLSVLEGQSLRLVCAVDS    211 - 280
NPPARLSWTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQEYTGKMRPVSG    281 - 350
VLLGAVGGAGATALVFLSFCVIFIVVRSCRKKSARPAADVGDIGMKDANTIRGSASQGNLTESWADDNPR    351 - 420
HHGLAAHSSGEEREIQYAPLSFHKGEPQDLSGQEATNNEYSEIKIPK                           421 - 467
//

Text Mined References (31)

PMID Year Title
24810846 2014 Siglec-7 is an inhibitory receptor on human mast cells and basophils.
24569453 2014 Interactions between Siglec-7/9 receptors and ligands influence NK cell-dependent tumor immunosurveillance.
24330394 2013 Sialic acid-binding Ig-like lectin-7 interacts with HIV-1 gp120 and facilitates infection of CD4pos T cells and macrophages.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23029261 2012 Engagement of Siglec-7 receptor induces a pro-inflammatory response selectively in monocytes.
22933622 2013 SIGLEC1 and SIGLEC7 expression in circulating monocytes of patients with multiple sclerosis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19710502 2009 The decreased expression of Siglec-7 represents an early marker of dysfunctional natural killer-cell subsets associated with high levels of HIV-1 viremia.
18331725 Differences in the constitutive and SIV infection induced expression of Siglecs by hematopoietic cells from non-human primates.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16895906 2006 Siglec-7 undergoes a major conformational change when complexed with the alpha(2,8)-disialylganglioside GT1b.
16828866 2007 Analysis of the CD33-related siglec family reveals that Siglec-9 is an endocytic receptor expressed on subsets of acute myeloid leukemia cells and absent from normal hematopoietic progenitors.
16732727 2006 Probing sialic acid binding Ig-like lectins (siglecs) with sulfated oligosaccharides.
16623661 2006 The structure of siglec-7 in complex with sialosides: leads for rational structure-based inhibitor design.
15703304 2005 Characterization of inhibitory signaling motifs of the natural killer cell receptor Siglec-7: attenuated recruitment of phosphatases by the receptor is attributed to two amino acids in the motifs.
15557178 2004 The membrane-proximal immunoreceptor tyrosine-based inhibitory motif is critical for the inhibitory signaling mediated by Siglecs-7 and -9, CD33-related Siglecs expressed on human monocytes and NK cells.
15292262 2004 Negative regulation of T cell receptor signaling by Siglec-7 (p70/AIRM) and Siglec-9.
14747738 2004 Structure of the saccharide-binding domain of the human natural killer cell inhibitory receptor p75/AIRM1.
12778482 2003 Ganglioside GD3 expression on target cells can modulate NK cell cytotoxicity via siglec-7-dependent and -independent mechanisms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438315 2003 High resolution crystal structures of Siglec-7. Insights into ligand specificity in the Siglec family.
11943481 2002 Genomic organization of the siglec gene locus on chromosome 19q13.4 and cloning of two new siglec pseudogenes.
11774609 2001 Regulation of myeloid cell proliferation and survival by p75/AIRM1 and CD33 surface receptors.
11546777 2001 A second uniquely human mutation affecting sialic acid biology.
11389909 2001 Binding specificity of siglec7 to disialogangliosides of renal cell carcinoma: possible role of disialogangliosides in tumor progression.
10764831 2000 Siglec-7: a sialic acid-binding lectin of the immunoglobulin superfamily.
10611343 1999 Engagement of p75/AIRM1 or CD33 inhibits the proliferation of normal or leukemic myeloid cells.
10567377 1999 Identification and characterization of a novel siglec, siglec-7, expressed by human natural killer cells and monocytes.
10514511 1999 TRAF family proteins interact with the common neurotrophin receptor and modulate apoptosis induction.
10499918 1999 Identification and molecular cloning of p75/AIRM1, a novel member of the sialoadhesin family that functions as an inhibitory receptor in human natural killer cells.
8188688 1994 SH3 domains of the adapter molecule Grb2 complex with two proteins in T cells: the guanine nucleotide exchange protein Sos and a 75-kDa protein that is a substrate for T cell antigen receptor-activated tyrosine kinases.