Property Summary

NCBI Gene PubMed Count 7
PubMed Score 10.98
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 1563 2.0e-05
osteosarcoma 7933 1.5e-04
adult high grade glioma 2148 1.6e-04
Disease Target Count Z-score Confidence
Toxic encephalopathy 131 3.083 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.102 1.5e-04
tuberculosis 1.400 2.0e-05
adult high grade glioma 1.100 1.6e-04

Gene RIF (1)

PMID Text
18629938 SIGLEC16 encodes a DAP12-associated receptor expressed in macrophages that evolved from its inhibitory counterpart SIGLEC11 and has functional and non-functional alleles in humans.

AA Sequence

MLLLPLLLPVLGAGSLNKDPSYSLQVQRQVPVPEGLCVIVSCNLSYPRDGWDESTAAYGYWFKGRTSPKT      1 - 70
GAPVATNNQSREVAMSTRDRFQLTGDPGKGSCSLVIRDAQREDEAWYFFRVERGSRVRHSFLSNAFFLKV     71 - 140
TALTQKPDVYIPETLEPGQPVTVICVFNWAFKKCPAPSFSWTGAALSPRRTRPSTSHFSVLSFTPSPQDH    141 - 210
DTDLTCHVDFSRKGVSAQRTVRLRVASLELQGNVIYLEVQKGQFLRLLCAADSQPPATLSWVLQDRVLSS    211 - 280
SHPWGPRTLGLELPGVKAGDSGRYTCRAENRLGSQQRALDLSVQYPPENLRVMVSQANRTVLENLRNGTS    281 - 350
LRVLEGQSLRLVCVTHSSPPARLSWTWGEQTVGPSQPSDPGVLQLPRVQMEHEGEFTCHARHPLGSQRVS    351 - 420
LSFSVHCKSGPMTGVVLVAVGEVAMKILLLCLCLILLRVRSCRRKAARAALGMEAADAVTD             421 - 481
//

Text Mined References (7)

PMID Year Title
22383531 2012 Evolution of siglec-11 and siglec-16 genes in hominins.
18629938 2008 SIGLEC16 encodes a DAP12-associated receptor expressed in macrophages that evolved from its inhibitory counterpart SIGLEC11 and has functional and non-functional alleles in humans.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11986327 2002 Cloning and characterization of human Siglec-11. A recently evolved signaling molecule that can interact with SHP-1 and SHP-2 and is expressed by tissue macrophages, including brain microglia.
11546777 2001 A second uniquely human mutation affecting sialic acid biology.