Property Summary

NCBI Gene PubMed Count 15
PubMed Score 12.96
PubTator Score 0.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.500 3.6e-02
dermatomyositis 1.600 2.8e-04
gastric carcinoma -1.300 1.3e-02
group 3 medulloblastoma -1.200 1.3e-03
invasive ductal carcinoma -1.200 1.3e-03
juvenile dermatomyositis 1.498 6.5e-13
malignant mesothelioma -1.100 3.6e-06
medulloblastoma, large-cell -1.300 8.3e-06
non-small cell lung cancer -1.182 2.4e-17
ovarian cancer -1.300 1.0e-07
pancreatic cancer -1.200 2.8e-05
primary pancreatic ductal adenocarcinoma -2.012 1.2e-04

Gene RIF (6)

AA Sequence

MFALGLPFLVLLVASVESHLGVLGPKNVSQKDAEFERTYVDEVNSELVNIYTFNHTVTRNRTEGVRVSVN      1 - 70
VLNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPTKNESEIQFFYVDVSTLSPV     71 - 140
NTTYQLRVSRMDDFVLRTGEQFSFNTTAAQPQYFKYEFPEGVDSVIVKVTSNKAFPCSVISIQDVLCPVY    141 - 210
DLDNNVAFIGMYQTMTKKAAITVQRKDFPSNSFYVVVVVKTEDQACGGSLPFYPFAEDEPVDQGHRQKTL    211 - 280
SVLVSQAVTSEAYVSGMLFCLGIFLSFYLLTVLLACWENWRQKKKTLLVAIDRACPESGHPRVLADSFPG    281 - 350
SSPYEGYNYGSFENVSGSTDGLVDSAGTGDLSYGYQGRSFEPVGTRPRVDSMSSVEEDDYDTLTDIDSDK    351 - 420
NVIRTKQYLYVADLARKDKRVLRKKYQIYFWNIATIAVFYALPVVQLVITYQTVVNVTGNQDICYYNFLC    421 - 490
AHPLGNLSAFNNILSNLGYILLGLLFLLIILQREINHNRALLRNDLCALECGIPKHFGLFYAMGTALMME    491 - 560
GLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGN    561 - 630
TAFWIVFSIIHIIATLLLSTQLYYMGRWKLDSGIFRRILHVLYTDCIRQCSGPLYVDRMVLLVMGNVINW    631 - 700
SLAAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGL    701 - 770
STWQKTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSFLVLLTLDDDLDTVQRDKIYVF            771 - 832
//

Text Mined References (16)

PMID Year Title