Property Summary

NCBI Gene PubMed Count 72
PubMed Score 66.48
PubTator Score 46.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Lens Diseases 2 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 2.7
Disease Target Count Z-score Confidence
Usher syndrome type 3 5 3.685 1.8
Cancer 2499 3.212 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.300 1.9e-02
malignant mesothelioma 1.600 1.7e-07
non-small cell lung cancer 1.294 1.7e-12
subependymal giant cell astrocytoma -1.119 2.8e-02

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (52)

AA Sequence

MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQ      1 - 70
HHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKY     71 - 140
ATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDI    141 - 210
NLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATP    211 - 280
RSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP                              281 - 324
//

Text Mined References (75)

PMID Year Title