Property Summary

NCBI Gene PubMed Count 103
PubMed Score 77.88
PubTator Score 89.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.828 1.4e-03
group 4 medulloblastoma 2.200 3.3e-07
medulloblastoma, large-cell 1.500 4.9e-04
primitive neuroectodermal tumor 1.500 2.1e-05
tuberculosis and treatment for 6 months 1.300 4.4e-05
atypical teratoid/rhabdoid tumor 1.100 1.4e-04
ovarian cancer -1.100 4.6e-04

Gene RIF (63)

PMID Text
26722480 In neuroblastoma cells, siRNA silencing of SIAH1 promoted cellular proliferation and suppressed apoptosis. Protein and mRNA expression of alpha-synuclein, LC3-II and p53 decreased after SIAH1 knockdown. E1 protein and mRNA levels increased after SIAH1 siRNA.
26654769 SIAH1 is associated with a tumor promoting role in breast cancer.
26438826 findings demonstrate that dissociation of the GAPDH/Siah1 pro-apoptotic complex can block high glucose-induced pericyte apoptosis, widely considered a hallmark feature of DR
26267146 Similar to TAp73, DNp73 is stabilized by hypoxia in a HIF-1a-dependent manner, which otherwise is degraded by Siah1.
26069251 miRNA network regulates SIAH1 in in colorectal metastasis tissues.
25851994 Results demonstrated that miR-107 directly down-regulated SIAH1 expression in human breast cancer cells. An inverse correlation between the expression of miR-107 and SIAH1 was found in human breast cancer tissues and cell lines.
25728284 CDK2 up-regulates the protein level of KLF10 through reducing its association with SIAH1, a KLF10 E3-ubiqutin ligase involved in proteasomal degradation.
25528765 Data indicate that ubiquitin ligase Siah as a regulator of to Mesenchymal Transition (EMT) by controlling the abundance of the key transcription factor Zeb1, while Siah itself is subject to regulation by EMT-inducing factors.
25391652 Siah1 is a substrate of ASK1 for activation of the GAPDH-Siah1 oxidative stress signaling cascade.
25202994 molecular basis of Siah1 and Siah2 E3 ubiquitin ligase substrate specificity
24882689 SIAH-1 plays an essential role in beta-catenin degradation in HCT116 CRC cells and that CSN5 affects beta-catenin target gene expression in these cells.
24503442 miR-135a/SIAH1/beta-catenin signaling is important in the transformation and progression of cervical carcinoma.
24316825 The spatial orientation of one zinc-finger subdomain in Siah1 ubiquitin ligase differs with respect to the rest of the dimeric protein.
23500468 USP19 interacts with the ubiquitin ligases SIAH1 and SIAH2, which promote USP19 ubiquitylation and degradation by the proteasome.
23228635 High expression of seven-in-absentia homologue 1 is associated with nasopharyngeal carcinoma.
23208506 the molecular mechanisms modulating ACK1
23152621 Calmodulin-regulated Siah-1A binding to mGluR5 dynamically regulates mGluR5 trafficking
22483617 Siah1 is the E3 ubiquitin ligase for ELL2 polyubiquitination and proteasomal degradation.
22037423 In sharp contrast to SIAH1/SIAH2 and UBCH8, TRIAD1 binding to PML-RARalpha has no effect on its turnover.
21878328 Siah-1 may play an important role in ubiquitin-dependent degradation of hepatitis B virus X protein and may be involved in suppressing the progression of hepatocellular carcinoma (HCC).
21633900 Taken together, our data suggest EFF1D functions as a novel negative regulator of SIAH-1.
21632771 infection of SIAH-1 knockdown cells with HSV, higher levels of ICP0 were produced, ICP0 was less ubiquitinated, and the half-life of this multifunctional viral regulatory protein was increased
21466614 results suggest that hypoxia downregulates beta-catenin by increasing Siah-1 expression in a p53-dependent manner
21185211 ARTS interacts with the E3 ligase Siah-1 (seven in absentia homolog 1) to induce ubiquitination and degradation of XIAP.
20682032 Overexpression of Siah1L and Siah1 is associated with radiosensitivity of breast cancer.
20604806 Herp temporarily bound to E3 ligase SIAH1a during proteolytic stress but not during ER stress.
20471960 these results propose a novel role of SIAH-1 in regulating the expression level of HPH2 through the ubiquitin-proteasome pathway.
20187294 Siah1 is a bona fide E2F1 target gene, which at least partly, mediates the suppression of beta-catenin/TCF signalling pathway
20181957 Direct ubiquitination of beta-catenin by Siah-1 and regulation by the exchange factor TBL1.
20144232 Immunofluorescence microscopy shows that the intracellular distribution of SIAH-1 and Kid/KIF22 appears to be modified in human tumor tissues compared to normal controls
20082325 increase of the function of SIAH1 to upregulate the expression of Bim may play an important role in the progression of breast cancer
19940145 siah-1 Protein is necessary for high glucose-induced glyceraldehyde-3-phosphate dehydrogenase nuclear accumulation and cell death in Muller
19775288 JNK and ERK signaling pathways may play an important role in the SIAH1-dependent biological behavior of breast cancer.
19696028 Data show that two mitotic kinases, Aurora-A and Aurora-B, phosphorylate endogenous EB3 at Ser-176, and the phosphorylation triggers disruption of the EB3-SIAH-1 complex, resulting in EB3 stabilization during mitosis.
19224863 synphilin-1A has a novel role as a regulator of SIAH activity, modulating alpha-synuclein, and formation of Lewy body-like inclusions
18850011 Siah1 (human) and Siah1A (mouse) reduced PHD3 protein levels similar to that observed with Siah2.
18536714 Results describe the control of HIPK2 stability by ubiquitin ligase Siah-1 and checkpoint kinases ATM and ATR.
18314624 SIAH-1 inhibition may represent a new therapeutic strategy in the treatment of human hepatocellular carcinoma.
18276110 SIAH1-induced degradation of TRB3 represents a potential regulatory mechanism for TGF-beta signaling.
18089810 SIAH may offer a novel therapeutic target to halt tumor growth and ameliorate RAS-mediated pancreatic cancer.
18070888 monoubiquitylation by SIAH1 and SIAH2 represents a possible trigger event for alpha-synuclein aggregation and Lewy body formation
18065497 Siah-1-mediated alpha-synuclein ubiquitination may play a critical role in Lewy body formation and Parkinson disease pathogenesis
17420721 Siah-1S (splice variant S) displays a promotion effect on cells tumorigenicity
16899216 HSiah1 lacks the self-regulatory catalytic activity displayed by the ring finger domain of hSiah2 in HEK293 cells.
16752048 Observational study of genotype prevalence. (HuGE Navigator)
16752048 genetic alterations of SIAH-1 do not significantly contribute to the pathogenesis of Parkinson disease
16615911 analysis of the substrate binding site of Siah ubiquitin ligase
16174773 GSK3beta modulates synphilin-1 ubiquitylation and cellular inclusion formation by SIAH
16085652 SIP engages Siah1 by means of two elements, both of which are required for mediating beta-catenin destruction in cells
15951807 Data show a signalling pathway in which nitric oxide generation that follows apoptotic stimulation elicits S-nitrosylation of GAPDH, which triggers binding to Siah1, nuclear translocation and apoptosis.
15467739 inactivating mutations of the Siah-1 may contribute to the development of gastric cancer through beta-catenin stabilization and apoptosis block
15326481 Siah-1L represents a new member of the human Siah family that is induced in response to p53 and plays an important role in the regulation of beta-catenin activity in tumor cells
15284290 polycystin-1 is regulated by Siah-1 through the ubiquitin-dependent proteasome pathway.
15221006 role of interaction with AF4 and AF4.MLL fusion protein in t(4,11) pathobiology
15163637 SIAH-mediated down regulation of alternative splicing may be an important developmental difference between otherwise highly conserved T-STAR proteins.
14985507 A p53-binding site was identified in the siah-1b promoter, located at nucleotides -2155/-2103 relative to the translational start site.
14506261 Siah-1 was found to abrogate the inhibitory effects of synphilin-1 on dopamine release
12810624 PEG10 protein associated with SIAH1, a mediator of apoptosis, and overexpression of PEG10 decreased the cell death mediated by SIAH1.
12557228 SIAH1 has been identified as a putative tumor suppressor gene for human hepatocellular carcinomas, with a correlation between its suppressed expression and tumor size and differentiation.
12421809 structural analysis and interaction with Siah-interacting protein
12399545 genetic regulation in tumor reversion
11852084 The Siah-1 gene promoter was cloned and the basic structure of the Siah-1 gene was determined.
11786535 Siah proteins function as E3 ubiquitin-protein ligases

AA Sequence

MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLT      1 - 70
CCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGS     71 - 140
LDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQ    141 - 210
LIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTIS    211 - 280
MC                                                                        281 - 282
//

Text Mined References (106)

PMID Year Title
26722480 2015 Silencing of SIAH1 in SH-SY5Y affects ?-synuclein degradation pathway.
26654769 2015 SIAH ubiquitin ligases regulate breast cancer cell migration and invasion independent of the oxygen status.
26438826 2015 High Glucose-induced Retinal Pericyte Apoptosis Depends on Association of GAPDH and Siah1.
26267146 2015 Hypoxia-induced DNp73 stabilization regulates Vegf-A expression and tumor angiogenesis similar to TAp73.
26069251 2015 A Systematic Approach to Defining the microRNA Landscape in Metastasis.
25851994 2016 MiR-107 down-regulates SIAH1 expression in human breast cancer cells and silencing of miR-107 inhibits tumor growth in a nude mouse model of triple-negative breast cancer.
25728284 2015 CDK2 phosphorylation regulates the protein stability of KLF10 by interfering with binding of the E3 ligase SIAH1.
25528765 2015 The ubiquitin ligase Siah is a novel regulator of Zeb1 in breast cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25391652 2015 Role of apoptosis signal-regulating kinase 1 (ASK1) as an activator of the GAPDH-Siah1 stress-signaling cascade.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25202994 2014 Investigating the molecular basis of Siah1 and Siah2 E3 ubiquitin ligase substrate specificity.
24882689 2014 The ?-catenin E3 ubiquitin ligase SIAH-1 is regulated by CSN5/JAB1 in CRC cells.
24503442 2014 miR-135a leads to cervical cancer cell transformation through regulation of ?-catenin via a SIAH1-dependent ubiquitin proteosomal pathway.
24316825 2013 Two high-resolution structures of the human E3 ubiquitin ligase Siah1.
23840749 2013 MOR is not enough: identification of novel mu-opioid receptor interacting proteins using traditional and modified membrane yeast two-hybrid screens.
23500468 2013 An N-terminal SIAH-interacting motif regulates the stability of the ubiquitin specific protease (USP)-19.
23228635 2013 Expression of seven-in-absentia homologue 1 and hypoxia-inducible factor 1 alpha: novel prognostic factors of nasopharyngeal carcinoma.
23208506 2013 SIAH ubiquitin ligases target the nonreceptor tyrosine kinase ACK1 for ubiquitinylation and proteasomal degradation.
23152621 2012 PKC phosphorylation regulates mGluR5 trafficking by enhancing binding of Siah-1A.
23001567 2012 Polycystin-1 regulates the stability and ubiquitination of transcription factor Jade-1.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
22483617 2012 The ubiquitin ligase Siah1 controls ELL2 stability and formation of super elongation complexes to modulate gene transcription.
22037423 2012 Differential regulation of PML-RAR? stability by the ubiquitin ligases SIAH1/SIAH2 and TRIAD1.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21878328 2011 E3 ubiquitin ligase Siah-1 facilitates poly-ubiquitylation and proteasomal degradation of the hepatitis B viral X protein.
21633900 2011 Eukaryotic translation elongation factor 1 delta inhibits the ubiquitin ligase activity of SIAH-1.
21632771 2011 Herpes simplex virus immediate-early protein ICP0 is targeted by SIAH-1 for proteasomal degradation.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21466614 2011 Hypoxia-induced ?-catenin downregulation involves p53-dependent activation of Siah-1.
21185211 2011 ARTS and Siah collaborate in a pathway for XIAP degradation.
21078624 2011 Comparison of an expanded ataxia interactome with patient medical records reveals a relationship between macular degeneration and ataxia.
20682032 2010 Siah1 proteins enhance radiosensitivity of human breast cancer cells.
20604806 2010 Deletion of Herp facilitates degradation of cytosolic proteins.
20508617 2010 Ubiquitin conjugase UBCH8 targets active FMS-like tyrosine kinase 3 for proteasomal degradation.
20471960 2010 SIAH-1 interacts with mammalian polyhomeotic homologues HPH2 and affects its stability via the ubiquitin-proteasome pathway.
20187294 2009 E2F1 represses beta-catenin/TCF activity by direct up-regulation of Siah1.
20181957 2010 Direct ubiquitination of beta-catenin by Siah-1 and regulation by the exchange factor TBL1.
20144232 2010 Distinct expression patterns of the E3 ligase SIAH-1 and its partner Kid/KIF22 in normal tissues and in the breast tumoral processes.
20082325 2010 The expression of SIAH1 is downregulated and associated with Bim and apoptosis in human breast cancer tissues and cells.
19940145 2010 siah-1 Protein is necessary for high glucose-induced glyceraldehyde-3-phosphate dehydrogenase nuclear accumulation and cell death in Muller cells.
19775288 2010 SIAH1 induced apoptosis by activation of the JNK pathway and inhibited invasion by inactivation of the ERK pathway in breast cancer cells.
19696028 2009 Mitotic regulation of the stability of microtubule plus-end tracking protein EB3 by ubiquitin ligase SIAH-1 and Aurora mitotic kinases.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19224863 2009 Synphilin-1A inhibits seven in absentia homolog (SIAH) and modulates alpha-synuclein monoubiquitylation and inclusion formation.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18850011 2009 Inhibition of Siah ubiquitin ligase function.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18536714 2008 Control of HIPK2 stability by ubiquitin ligase Siah-1 and checkpoint kinases ATM and ATR.
18314624 2007 [Reduced expression of the E3-ubiquitin ligase seven in absentia homologue (SIAH)-1 in human hepatocellular carcinoma].
18276110 2008 E3 ubiquitin ligase SIAH1 mediates ubiquitination and degradation of TRB3.
18089810 2007 Inhibition of RAS-mediated transformation and tumorigenesis by targeting the downstream E3 ubiquitin ligase seven in absentia homologue.
18070888 2008 Monoubiquitylation of alpha-synuclein by seven in absentia homolog (SIAH) promotes its aggregation in dopaminergic cells.
18065497 2008 Ubiquitination of alpha-synuclein by Siah-1 promotes alpha-synuclein aggregation and apoptotic cell death.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17420721 2007 Siah-1S, a novel splice variant of Siah-1 (seven in absentia homolog), counteracts Siah-1-mediated downregulation of beta-catenin.
16899216 2006 Dimerization of hSiah proteins regulates their stability.
16752048 2006 Mutation analysis of the seven in absentia homolog 1 (SIAH1) gene in Parkinson's disease.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16615911 2006 Elucidation of the substrate binding site of Siah ubiquitin ligase.
16230351 2006 Siah1 interacts with the scaffold protein POSH to promote JNK activation and apoptosis.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16174773 2005 Glycogen synthase kinase 3beta modulates synphilin-1 ubiquitylation and cellular inclusion formation by SIAH: implications for proteasomal function and Lewy body formation.
16085652 2005 Structural analysis of Siah1-Siah-interacting protein interactions and insights into the assembly of an E3 ligase multiprotein complex.
15951807 2005 S-nitrosylated GAPDH initiates apoptotic cell death by nuclear translocation following Siah1 binding.
15492505 2004 Siah: new players in the cellular response to hypoxia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467739 2004 Inactivating mutations of the Siah-1 gene in gastric cancer.
15326481 2004 Siah-1L, a novel transcript variant belonging to the human Siah family of proteins, regulates beta-catenin activity in a p53-dependent manner.
15284290 2004 Siah-1 interacts with the intracellular region of polycystin-1 and affects its stability via the ubiquitin-proteasome pathway.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15221006 2004 Interaction of AF4 wild-type and AF4.MLL fusion protein with SIAH proteins: indication for t(4;11) pathobiology?
15163637 2004 SIAH1 targets the alternative splicing factor T-STAR for degradation by the proteasome.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15064394 2004 Ubiquitylation of synphilin-1 and alpha-synuclein by SIAH and its presence in cellular inclusions and Lewy bodies imply a role in Parkinson's disease.
14985507 2004 Siah-1b is a direct transcriptional target of p53: identification of the functional p53 responsive element in the siah-1b promoter.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654780 2003 SIAH-1 interacts with CtIP and promotes its degradation by the proteasome pathway.
14645235 2004 The coiled-coil domain is the structural determinant for mammalian homologues of Drosophila Sina-mediated degradation of promyelocytic leukemia protein and other tripartite motif proteins by the proteasome.
14506261 2003 Siah-1 facilitates ubiquitination and degradation of synphilin-1.
12810624 2003 Involvement of PEG10 in human hepatocellular carcinogenesis through interaction with SIAH1.
12646221 2003 Inhibition of ubiquitin ligase Siah-1A by disabled-1.
12557228 2003 SIAH1 inactivation correlates with tumor progression in hepatocellular carcinomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421809 2003 Structural analysis of Siah1 and its interactions with Siah-interacting protein (SIP).
12399545 2002 Biological models and genes of tumor reversion: cellular reprogramming through tpt1/TCTP and SIAH-1.
12072443 2002 Modulation of transforming growth factor beta (TGFbeta)/Smad transcriptional responses through targeted degradation of TGFbeta-inducible early gene-1 by human seven in absentia homologue.
11863358 2002 An anthropoid-specific locus of orphan C to U RNA-editing enzymes on chromosome 22.
11786535 2002 Regulation of synaptophysin degradation by mammalian homologues of seven in absentia.
11752454 2001 Siah-1 binds and regulates the function of Numb.
11483518 2001 Regulation of BOB.1/OBF.1 stability by SIAH.
11483517 2001 The RING finger protein Siah-1 regulates the level of the transcriptional coactivator OBF-1.
11389840 2001 Siah-1 mediates a novel beta-catenin degradation pathway linking p53 to the adenomatous polyposis coli protein.
11389839 2001 Siah-1, SIP, and Ebi collaborate in a novel pathway for beta-catenin degradation linked to p53 responses.
11146551 2000 SIAH-1 interacts with alpha-tubulin and degrades the kinesin Kid by the proteasome pathway during mitosis.
10956387 2000 Lack of somatic mutation in the coding sequence of SIAH1 in tumors hemizygous for this candidate tumor suppressor gene.
10747903 2000 p53 suppresses the c-Myb-induced activation of heat shock transcription factor 3.
10681424 2000 Pw1/Peg3 is a potential cell death mediator and cooperates with Siah1a in p53-mediated apoptosis.
9858595 1999 Siah-1 N-terminal RING domain is required for proteolysis function, and C-terminal sequences regulate oligomerization and binding to target proteins.
9822659 1998 Characterization of cDNAs encoding the p44 and p35 subunits of human translation initiation factor eIF3.
9582267 1998 p53-inducible human homologue of Drosophila seven in absentia (Siah) inhibits cell growth: suppression by BAG-1.
9403064 1997 Characterization of human homologs of the Drosophila seven in absentia (sina) gene.
9334332 1997 Mammalian homologs of seven in absentia regulate DCC via the ubiquitin-proteasome pathway.
8799150 1996 Activation of the human homologue of the Drosophila sina gene in apoptosis and tumor suppression.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.