Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.32
PubTator Score 8.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -1.600 1.5e-02
adult high grade glioma -1.300 3.6e-03
astrocytic glioma -2.100 4.9e-02
atypical teratoid / rhabdoid tumor -2.300 7.6e-05
ependymoma -2.300 2.7e-02
glioblastoma -1.500 1.3e-03
group 4 medulloblastoma -1.100 9.4e-03
invasive ductal carcinoma 1.013 3.3e-02
lung cancer 1.900 9.4e-05
medulloblastoma, large-cell -1.700 9.3e-04
mucosa-associated lymphoid tissue lympho... 1.428 4.4e-02
oligodendroglioma -1.500 5.0e-08
ovarian cancer -1.400 8.9e-07
tuberculosis 1.500 4.0e-06

Gene RIF (3)

AA Sequence

MNSSDEEKQLQLITSLKEQAIGEYEDLRAENQKTKEKCDKIRQERDEAVKKLEEFQKISHMVIEEVNFMQ      1 - 70
NHLEIEKTCRESAEALATKLNKENKTLKRISMLYMAKLGPDVITEEINIDDEDSTTDTDGAAETCVSVQC     71 - 140
QKQIKELRDQIVSVQEEKKILAIELENLKSKLVEVIEEVNKVKQEKTVLNSEVLEQRKVLEKCNRVSMLA    141 - 210
VEEYEEMQVNLELEKDLRKKAESFAQEMFIEQNKLKRQSHLLLQSSIPDQQLLKALDENAKLTQQLEEER    211 - 280
IQHQQKVKELEEQLENETLHKEIHNLKQQLELLEEDKKELELKYQNSEEKARNLKHSVDELQKRVNQSEN    281 - 350
SVPPPPPPPPPLPPPPPNPIRSLMSMIRKRSHPSGSGAKKEKATQPETTEEVTDLKRQAVEEMMDRIKKG    351 - 420
VHLRPVNQTARPKTKPESSKGCESAVDELKGILGTLNKSTSSRSLKSLDPENSETELERILRRRKVTAEA    421 - 490
DSSSPTGILATSESKSMPVLGSVSSVTKTALNKKTLEAEFNSPSPPTPEPGEGPRKLEGCTSSKVTFQPP    491 - 560
SSIGCRKKYIDGEKQAEPVVVLDPVSTHEPQTKDQVAEKDPTQHKEDEGEIQPENKEDSIENVRETDSSN    561 - 630
C//

Text Mined References (28)

PMID Year Title