Property Summary

NCBI Gene PubMed Count 27
PubMed Score 43.09
PubTator Score 46.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 7.100 3.1e-10
psoriasis -2.900 6.0e-05
glioblastoma 2.700 2.2e-03
osteosarcoma 3.556 1.2e-04
medulloblastoma 3.400 1.7e-02
cystic fibrosis -1.399 5.7e-05
atypical teratoid / rhabdoid tumor 2.200 6.9e-03
medulloblastoma, large-cell 5.300 1.1e-04
primitive neuroectodermal tumor 3.200 3.8e-02
non-small cell lung cancer 1.058 4.8e-08
lung cancer 3.700 6.5e-07
adult high grade glioma 3.200 5.5e-03
primary Sjogren syndrome 1.100 2.7e-04
invasive ductal carcinoma -1.300 7.9e-03
ovarian cancer -1.900 4.8e-05

 GO Component (1)

Gene RIF (17)

PMID Text
25675432 The longitudinal measurement of extracellular plasma mSHOX2 DNA yields information about the response to cytotoxic treatment and allows an early assessment of treatment response for lung cancer patients.
25533636 SHOX2 overexpression favors differentiation of embryonic stem cells into cardiac pacemaker cells, improving biological pacing ability.
25331797 SHOX2 DNA methylation identified 66% of the patients with cancer subsequent to a cytological equivocal diagnosis. SHOX2 complements the cytological diagnosis and the methylation marker panel.
24746361 miR-375/SHOX2 functional relationship regulates breast tumorigenesis by controlling the process of EMT.
24421874 SHOX2, like SHOX, regulates NPPB directly whilst activates ACAN via its cooperation with the SOX trio.
24386354 prognostic value of SHOX2 and SEPT9 DNA methylation in benign, paramalignant and malignant pleural effusions
24136974 The assay is based on quantification of methylated Short Stature Homeobox gene two (SHOX2) DNA in the specimen measured via multiplex real-time Polymerase Chain Reaction (PCR) on bisulfite-converted DNA.
24026539 The combination of EBUS-TBNA and SHOX2 methylation level strongly improves the assessment of the nodal status by identifying additional malignant lesions and confirming benign nodes and therefore avoiding invasive follow-up procedures.
23851611 Elevated SHOX2 expression is associated with tumor recurrence of hepatocellular carcinoma.
23038774 Shox2 regulates progression through chondrogenesis at two distinct stages--the onset of early differentiation and the transition to maturation and hypertrophy.
22555092 DNA methylation of PITX2 and SHOX2 is an independent prognostic biomarker for disease progression in non-small-cell lung cancer patients.
22108652 A CE marked in vitro diagnostic test kit to quantify SHOX2 DNA methylation in bronchial aspirates was developed and characterized.
21694641 SHOX2 DNA methylation is associated with lung cancer.
21426551 Frequent gene amplification correlated with hypermethylation of the SHOX2 gene locus.
21047392 SHOX2 DNA methylation is found in bronchial aspirates of lung cancer patients
20858598 work establishes a link between Tbx5, Shox2 and Bmp4 in the pacemaker region of the developing heart
19453261 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPTGCTEAGRDDRSSPAVRAAGGGGGGGGGGG      1 - 70
GGGGGGGVGGGGAGGGAGGGRSPVRELDMGAAERSREPGSPRLTEVSPELKDRKEDAKGMEDEGQTKIKQ     71 - 140
RRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHKGVLIGA    141 - 210
ASQFEACRVAPYVNVGALRMPFQQDSHCNVTPLSFQVQAQLQLDSAVAHAHHHLHPHLAAHAPYMMFPAP    211 - 280
PFGLPLATLAADSASAASVVAAAAAAKTTSKNSSIADLRLKAKKHAAALGL                       281 - 331
//

Text Mined References (27)

PMID Year Title
25675432 2015 Quantification of cell-free mSHOX2 Plasma DNA for therapy monitoring in advanced stage non-small cell (NSCLC) and small-cell lung cancer (SCLC) patients.
25533636 2015 SHOX2 overexpression favors differentiation of embryonic stem cells into cardiac pacemaker cells, improving biological pacing ability.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25331797 Analysis of SHOX2 methylation as an aid to cytology in lung cancer diagnosis.
24746361 2014 SHOX2 is a direct miR-375 target and a novel epithelial-to-mesenchymal transition inducer in breast cancer cells.
24421874 2014 NPPB and ACAN, two novel SHOX2 transcription targets implicated in skeletal development.
24386354 2013 Diagnostic and prognostic value of SHOX2 and SEPT9 DNA methylation and cytology in benign, paramalignant and malignant pleural effusions.
24136974 SHOX2 DNA methylation is a tumour marker in pleural effusions.
24026539 2013 Assessment of SHOX2 methylation in EBUS-TBNA specimen improves accuracy in lung cancer staging.
23851611 2013 Elevated SHOX2 expression is associated with tumor recurrence of hepatocellular carcinoma.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23038774 2012 Shox2 regulates progression through chondrogenesis in the mouse proximal limb.
22555092 2012 DNA methylation of the homeobox genes PITX2 and SHOX2 predicts outcome in non-small-cell lung cancer patients.
22108652 2012 Performance evaluation of the DNA methylation biomarker SHOX2 for the aid in diagnosis of lung cancer based on the analysis of bronchial aspirates.
21694641 2011 SHOX2 DNA methylation is a biomarker for the diagnosis of lung cancer in plasma.
21426551 2011 Correlation of SHOX2 gene amplification and DNA methylation in lung cancer tumors.
21047392 2010 SHOX2 DNA methylation is a biomarker for the diagnosis of lung cancer based on bronchial aspirates.
20858598 2010 Shox2 mediates Tbx5 activity by regulating Bmp4 in the pacemaker region of the developing heart.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9858825 1998 Assignment of SHOX2 (alias OG12X and SHOT) to human chromosome bands 3q25-->q26.1 by in situ hybridization.
9482898 1998 SHOT, a SHOX-related homeobox gene, is implicated in craniofacial, brain, heart, and limb development.
9466998 1998 A new human homeobox gene OGI2X is a member of the most conserved homeobox gene family and is expressed during heart development in mouse.