Property Summary

NCBI Gene PubMed Count 103
PubMed Score 286.87
PubTator Score 329.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Leri-Weill dyschondrosteosis 7
Abnormality of calvarial morphology 1
Abnormality of epiphysis morphology 39
Abnormality of skull bone morphology 1
Abnormality of the femur 6
Abnormality of the hip bone 16
Abnormality of the humerus 6
Abnormality of the metaphyses 48
Abnormality of the ulna 10
Acquired cubitus valgus 18
Acquired scoliosis 281
Bilateral fifth finger clinodactyly 110
Bowing of the long bones 31
Brachydactyly 156
Broad flat nasal bridge 236
Byzanthine arch palate 194
Carpal bone anomalies 5
Concave bridge of nose 195
Cone-shaped epiphyses 24
Congenital hypoplasia of radius 23
Curvature of little finger 110
Curvature of spine 282
Depressed nasal bridge 195
Depressed nasal root/bridge 195
Diaphyseal thickening 11
Dorsal subluxation of ulna 1
Dwarfism 37
Exostoses 11
Genu varum 29
Hypoplasia of lower limb 4
Hypoplastic feet 66
Hypoplastic fingernails 11
Hypoplastic mandible condyle 275
Hypoplastic-absent toenails 11
Hypoplastic/aplastic fibulae 5
Joint stiffness 84
Ketoacidosis, episodic 4
Knee joint valgus deformity 56
Langer Mesomelic Dysplasia Syndrome 1
Limited wrist movement 1
Madelung Deformity 5
Mandibular hypoplasia 275
Mesomelia 8
Mesomelic/rhizomelic limb shortening 1
Micrognathism 275
Micromelia 58
Nasal bridge wide 236
Obesity 678
Patellar aplasia 8
Radial bowing 13
Radial ray hypoplasia 23
Short Stature, Idiopathic, Autosomal 4
Short femoral neck 15
Short limb dwarfism, disproportionate 22
Short neck 140
Short stature 531
Short tibia 9
Short ulnae 24
Shortened forearm 1
Skeletal muscle hypertrophy 16
Tibial bowing 19
ULNAR HYPOPLASIA 24
Ulnar bowing 10
Ulnar deviation of the fingers 21
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Turner syndrome 28 7.162 3.6

Expression

Gene RIF (98)

AA Sequence

MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDITEGGGHCPVHL      1 - 70
FKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDEDGQTKLKQRRSRTNFTLEQLNELERLFDETH     71 - 140
YPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMHKGVILGTANHLDACRVAPYVNMGALRMPFQ    141 - 210
QVQAQLQLEGVAHAHPHLHPHLAAHAPYLMFPPPPFGLPIASLAESASAAAVVAAAAKSNSKNSSIADLR    211 - 280
LKARKHAEALGL                                                              281 - 292
//

Text Mined References (105)

PMID Year Title