Property Summary

NCBI Gene PubMed Count 28
PubMed Score 52.64
PubTator Score 37.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.100 5.9e-04
medulloblastoma, large-cell -1.400 1.7e-04
Multiple myeloma 1.221 1.6e-02
ovarian cancer -1.400 7.6e-04
Waldenstrons macroglobulinemia 1.343 4.9e-03

Gene RIF (19)

AA Sequence

MSSSLGKEKDSKEKDPKVPSAKEREKEAKASGGFGKESKEKEPKTKGKDAKDGKKDSSAAQPGVAFSVDN      1 - 70
TIKRPNPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPSSIKELTQLTELYLYSNKLQSLPA     71 - 140
EVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKD    141 - 210
IKNLSKLSMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTI    211 - 280
GNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGG    281 - 350
PSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPED    351 - 420
VSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGI    421 - 490
GHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQI    491 - 560
VAGGPSFIIQFLKMQGPYRAMV                                                    561 - 582
//

Text Mined References (31)

PMID Year Title