Property Summary

NCBI Gene PubMed Count 43
PubMed Score 231.67
PubTator Score 52.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Multiple myeloma 1.212 2.7e-02
psoriasis -2.000 5.3e-04
astrocytoma 1.200 1.4e-15
glioblastoma 1.800 1.3e-04
oligodendroglioma 1.600 5.9e-15
osteosarcoma -1.946 8.2e-04
sonic hedgehog group medulloblastoma 2.100 6.9e-08
medulloblastoma, large-cell 1.700 1.9e-03
Atopic dermatitis 1.100 2.5e-03
adrenocortical carcinoma 1.167 5.0e-03
pancreatic ductal adenocarcinoma liver m... -1.479 7.9e-03
non-small cell lung cancer 2.104 1.9e-27
lung cancer 2.400 3.3e-05
colon cancer 1.600 1.7e-04
diabetes mellitus -1.100 3.0e-03
pediatric high grade glioma 1.800 1.4e-06
posterior fossa group A ependymoma 1.300 2.1e-08
non primary Sjogren syndrome sicca 1.100 4.0e-02
nasopharyngeal carcinoma 1.200 3.1e-03
lung adenocarcinoma 1.747 1.8e-06
acute myeloid leukemia -1.200 3.9e-02
ovarian cancer 2.100 7.9e-07
Breast cancer 1.400 8.9e-07

Protein-protein Interaction (2)

Gene RIF (15)

PMID Text
26975021 High SHMT2 expression increases glycine-dependent nucleotide synthesis leading to bladder cancer growth.
26103880 The SHMT-2 is the direct targets of miR-370 and miR-373, respectively, in human articular chondrocytes.
25855294 SHMT2 is required for glioblastoma multiforme cells to adapt to the tumour environment, but also renders these cells sensitive to glycine cleavage system inhibition
25619277 SHMT1 exists in solution as a tetramer, both in the absence and presence of PLP, while SHMT2 undergoes a dimer-to-tetramer transition.
22220685 The present study not only describes individual genetic variation that directly affects SHMT1 and SHMT2 activity, but provided insight into the overall regulation of the Folate and Methionine Cycles.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19513116 SHMT1 and SHMT2 are functionally redundant in nuclear de novo thymidylate biosynthesis
19086053 Observational study of gene-disease association. (HuGE Navigator)
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18988749 Observational study of genetic testing. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
11386852 Observational study of gene-disease association. (HuGE Navigator)
9573390 This paper compares the mitochondrial and cytoplasmic forms of this enzyme and suggests that the two genes are a result of a single gene duplication.

AA Sequence

MLYFSLFWAARPLQRCGQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRG      1 - 70
LELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQP     71 - 140
YSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPKTGLIDYNQLA    141 - 210
LTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHK    211 - 280
TLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREY    281 - 350
SLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAIT    351 - 420
PGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVE    421 - 490
QFARAFPMPGFDEH                                                            491 - 504
//

Text Mined References (50)

PMID Year Title
26975021 2016 Metabolic phenotype of bladder cancer.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26103880 2015 miR-370 and miR-373 regulate the pathogenesis of osteoarthritis by modulating one-carbon metabolism via SHMT-2 and MECP-2, respectively.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25902260 2015 Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment.
25855294 2015 SHMT2 drives glioma cell survival in ischaemia but imposes a dependence on glycine clearance.
25619277 2015 How pyridoxal 5'-phosphate differentially regulates human cytosolic and mitochondrial serine hydroxymethyltransferase oligomeric state.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223914 2013 Proteomic identification of mitochondrial targets of arginase in human breast cancer.
24075985 2013 A BRISC-SHMT complex deubiquitinates IFNAR1 and regulates interferon responses.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22220685 2012 Serine hydroxymethyltransferase 1 and 2: gene sequence variation and functional genomic characterization.
21876188 2011 Identification of a de novo thymidylate biosynthesis pathway in mammalian mitochondria.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19513116 2009 SHMT1 and SHMT2 are functionally redundant in nuclear de novo thymidylate biosynthesis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19048631 2009 Oral facial clefts and gene polymorphisms in metabolism of folate/one-carbon and vitamin A: a pathway-wide association study.
18988749 2009 MALDI-TOF MS genotyping of polymorphisms related to 1-carbon metabolism using common and mass-modified terminators.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18063578 2008 The layered structure of human mitochondrial DNA nucleoids.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17482557 2007 Effect of vitamin B6 availability on serine hydroxymethyltransferase in MCF-7 cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11516159 2001 The role of serine hydroxymethyltransferase isozymes in one-carbon metabolism in MCF-7 cells as determined by (13)C NMR.
11386852 2001 Is mutated serine hydroxymethyltransferase (SHMT) involved in the etiology of neural tube defects?
10828359 2000 The genetic organization and protein crystallographic structure of human serine hydroxymethyltransferase.
10549165 1999 Affinity properties of phosvitin: interaction of phosvitin with serine hydroxymethyl transferase.
9639330 1998 Glycine is not formed through the amino transferase reaction in human or rat placenta.
9573390 1998 Molecular cloning, characterization and alternative splicing of the human cytoplasmic serine hydroxymethyltransferase gene.
9497969 1997 Pyridoxine deficiency: new approaches in immunosuppression and chemotherapy.
8999870 1997 Molecular cloning, characterization, and regulation of the human mitochondrial serine hydroxymethyltransferase gene.
8505317 1993 Cloning of human cDNAs encoding mitochondrial and cytosolic serine hydroxymethyltransferases and chromosomal localization.
8435385 1993 Abnormal serine-glycine metabolism in the brains of schizophrenics.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.