Property Summary

NCBI Gene PubMed Count 121
PubMed Score 360.25
PubTator Score 153.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
nephrosclerosis -1.427 7.6e-03
esophageal adenocarcinoma -1.500 3.2e-02
psoriasis 1.300 3.5e-03
atypical teratoid / rhabdoid tumor 1.200 2.6e-05
medulloblastoma, large-cell 1.400 3.6e-04
pancreatic ductal adenocarcinoma liver m... -3.079 7.5e-04
ductal carcinoma in situ -1.900 2.0e-05
invasive ductal carcinoma -1.300 7.4e-03

Protein-protein Interaction (8)

Gene RIF (105)

PMID Text
26316272 an association between MTRR 66 and SHMT1 1420 polymorphisms and spaceflight-induced vision changes
26125758 our meta-analysis suggested that the SHMT1 C1420T polymorphism was associated with decreased risk of breast cancer.
25619277 SHMT1 exists in solution as a tetramer, both in the absence and presence of PLP, while SHMT2 undergoes a dimer-to-tetramer transition.
25412303 SHMT1 knockdown in lung cancer cells leads to cell cycle arrest and to p53-dependent apoptosis.
25194438 In this meta-analysis, SHMT1 C1420T polymorphism did not have a significant association with the risk of cancer overall.
24789272 found evidence for association of SHMT1 C1420T polymorphism with significantly reduced risk of breast cancer in Asians
24716966 SHMT1 C1420T polymorphism is not associated with overall cancer development.
24641398 serine hydroxymethyltransfarase C1420T reduces risk for both acute lymphoblastic leukemia and acute myeloid leukemia and influences disease progression in acute lymphoblastic leukemia
24362509 SHMT1 C1420T and DNMT3B C46359T polymorphisms are not associated with HNC development in Brazilian population, however, SHMT1 C1420T polymorphism is less frequent in patients with primary site of tumor in larynx
23474074 The link between mitochondrial serine hydroxymethyltransferase activity and heme biosynthesis represents an important aspect of the whole picture of cancer cell metabolism.
23421317 There is an association between DHFR DD/SHMT TT and DHFR II/SHMT TT combined genotypes and folate and MMA concentrations in individuals with Down syndrome.
23322534 geography-specific effects of the SHMT1 polymorphism that render Europeans susceptible to colorectal caner, but not Americans.
22803112 No statistically significant association with prostate cancer was detected for the polymorphic locus C1420T of SHMT1 gene.
22220685 The present study not only describes individual genetic variation that directly affects SHMT1 and SHMT2 activity, but provided insight into the overall regulation of the Folate and Methionine Cycles.
22194612 SUMO and ubiquitin modification of SHMT1 occurs on the same lysine residue and determine the localization and accumulation of SHMT1 in the nucleus.
22044939 The univariate and multivariate analyses demonstrated that the SHMT1 1420T allele was associated with better response (P=0.025) and longer progression-free survival (PFS) (P=0.00004) and overall survival (OS)
21987236 MTRR A66G and cSHMT C1420T polymorphisms influence CpG island methylator phenotype of BNIP3, thus epigenetically regulating BNIP3 in breast cancer
21687976 A protective role for the genotypes SHMT-1420 CC and CT on maternal risk for Down syndrome.
21178087 there was an interaction between SHMT1 and MTHFR such that the association of the MTHFR rs1801133 CT genotype with an increased CVD risk was stronger in the presence of SHMT1 rs1979277 TT genotype.
21090237 Polymorphic variants of folate metabolizing genes (C677T and A1298C MTHFR, C1420T SHMT1 and G1958A MTHFD) are not associated with the risk of breast cancer in West Siberian Region of Russia
21055808 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20977478 SHMT1 levels are found to be higher in schizophrenic brains compared to controls.
20977478 Observational study of gene-disease association. (HuGE Navigator)
20920350 SHMT1 1420 and MTHFR 677 polymorphisms are associated only with development of rectal and not colon cancer
20920350 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20852008 Observational study of gene-disease association. (HuGE Navigator)
20842733 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20737570 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20670920 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20615890 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20544798 Observational study of gene-disease association. (HuGE Navigator)
20511665 Observational study of gene-disease association. (HuGE Navigator)
20458436 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20386493 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20101025 Observational study of gene-disease association. (HuGE Navigator)
20031554 Observational study of gene-disease association. (HuGE Navigator)
19858780 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19777601 Observational study of gene-disease association. (HuGE Navigator)
19776626 Polymorphisms in methionine synthase, methionine synthase reductase and serine hydroxymethyltransferase, folate and alcohol intake, and colon cancer risk.
19774638 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19751277 No asssociation between SHMT1 single nucleotide polymorphism 1420C > T and both, follicular lymphoma and diffuse, large B-Cell lymphoma was observed in a cohort of swedish patients.
19734143 Interactions between the 5'-UTR and 3'-UTR achieve maximal internal ribosome entry site-mediated translation of SHMT1.
19707223 No evidence for an association between the cSHMT genotype and breast cancer was observed. There was also no evidence of a gene-gene interaction between cSHMT and MTHFR.
19707223 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19706844 Meta-analysis of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19619240 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19513116 SHMT1 and SHMT2 are functionally redundant in nuclear de novo thymidylate biosynthesis
19336370 Observational study of gene-disease association. (HuGE Navigator)
19223009 Observational study of gene-disease association. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19159907 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19064578 Observational study of gene-disease association. (HuGE Navigator)
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19020309 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18996879 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18830263 Observational study of gene-disease association. (HuGE Navigator)
18635682 Observational study of gene-disease association. (HuGE Navigator)
18427977 Observational study of genetic testing. (HuGE Navigator)
18381459 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18378616 For cSHMT 1420 CC genotype, particulates <2.5 were associated with significant decreases in normal-to-normal std deviation & heart rate, but not for CT/TT. For PM2.5 level. Interaction with C1420T cSHMT genotype was statistically significant for both.
18378616 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17904392 Observational study of gene-disease association. (HuGE Navigator)
17896178 our study provides support to account for the preferential role of cytosolic serine hydroxymethyltransferase polymorphism to lower risk of female breast cancer
17896178 Observational study of gene-disease association. (HuGE Navigator)
17891500 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17595805 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17482557 vitamin B(6) restriction decreases the activity and stability of SHMT
17446168 Results describe the mechanism for the preferential partitioning of cytoplasmic serine hydroxymethyltransferase (cSHMT)-derived methylenetetrahydrofolate to de novo thymidylate biosynthesis
17420066 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17420066 Subjects carrying the combined 3+ risk variant genotypes of SHMT1 had an increased risk of lung cancer.
17311260 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17311259 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17206530 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17206530 study demonstrates an association of the MTHFR C677T and SHMT(1) C1420T polymorphism with the risk of esophageal squamous cell carcinoma and gastric cardia adenocarcinoma
17119116 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17113224 Observational study of gene-disease association. (HuGE Navigator)
17074544 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17074544 Possibility of a direct or indirect role for the SHMT1(1420)T variant in spontaneous preterm or SGA births.
17035141 Observational study of gene-disease association. (HuGE Navigator)
16536979 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16447238 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16365025 Observational study of gene-disease association. (HuGE Navigator)
16049973 increased expression of truncated cSHMT, Tbx3 and utrophin in plasma samples obtained from patients at early stages of ovarian cancer and breast cancer
16046727 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16006999 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15797993 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15598699 The low activity of SHMT in the human and rat placenta suggests that, unlike in the sheep, placental conversion of serine to glycine is not a major source of fetal glycine in these species.
15531579 SHMT1 is a zinc-inducible gene, which provides the first mechanism for the regulation of folate-mediated one-carbon metabolism by zinc
15198953 Observational study of gene-disease association. (HuGE Navigator)
15122597 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15060097 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15059614 Observational study of gene-disease association. (HuGE Navigator)
14656021 Observational study of gene-disease association. (HuGE Navigator)
12615003 The region missing in the shorter isoform is relatively short and is located on the cell surface.
12604405 Observational study of gene-disease association. (HuGE Navigator)
12604405 Associations between polymorphisms in the thymidylate synthase and SHMT1 genes and susceptibility to malignant lymphoma.
12161434 These results indicate that cSHMT is a metabolic switch that, when activated, gives dTMP synthesis higher metabolic priority than S-adenosylmethionine synthesis.
11386852 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLN      1 - 70
NKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMG     71 - 140
LDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLE    141 - 210
YARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVKSVDPKT    211 - 280
GKEILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIV    281 - 350
TGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQK    351 - 420
VAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPDF           421 - 483
//

Text Mined References (127)

PMID Year Title
26316272 2016 Genotype, B-vitamin status, and androgens affect spaceflight-induced ophthalmic changes.
26125758 2015 Clinical significance of SHMT1 rs1979277 polymorphism in Asian solid tumors: evidence from a meta-analysis.
25619277 2015 How pyridoxal 5'-phosphate differentially regulates human cytosolic and mitochondrial serine hydroxymethyltransferase oligomeric state.
25416956 2014 A proteome-scale map of the human interactome network.
25412303 2014 SHMT1 knockdown induces apoptosis in lung cancer cells by causing uracil misincorporation.
25194438 2014 Association between cytosolic serine hydroxymethyltransferase (SHMT1) gene polymorphism and cancer risk: a meta-analysis.
24789272 2014 Polymorphism of cytosolic serine hydroxymethyltransferase and breast cancer risk: evidence from a meta-analysis.
24716966 2014 C1420T polymorphism of cytosolic serine hydroxymethyltransferase and risk of cancer: a meta-analysis.
24698160 2014 Distinct biochemical properties of human serine hydroxymethyltransferase compared with the Plasmodium enzyme: implications for selective inhibition.
24641398 2014 Association of thymidylate synthase 5'-UTR 28bp tandem repeat and serine hydroxymethyltransfarase C1420T polymorphisms with susceptibility to acute leukemia.
24362509 2014 DNMT3B C46359T and SHMT1 C1420T polymorphisms in the folate pathway in carcinogenesis of head and neck.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223914 2013 Proteomic identification of mitochondrial targets of arginase in human breast cancer.
24075985 2013 A BRISC-SHMT complex deubiquitinates IFNAR1 and regulates interferon responses.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23474074 2013 Glycine consumption and mitochondrial serine hydroxymethyltransferase in cancer cells: the heme connection.
23421317 2013 DHFR 19-bp deletion and SHMT C1420T polymorphisms and metabolite concentrations of the folate pathway in individuals with Down syndrome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23322534 2013 A meta-analysis of the C1420T polymorphism in cytosolic serine hydroxymethyltransferase (SHMT1) among Caucasian colorectal cancer populations.
22803112 2012 Role of polymorphic variants of MTR gene A2756G and SHMT1 gene C1420T in the development of prostatic cancer in residents of the Western Siberian Region of Russia.
22220685 2012 Serine hydroxymethyltransferase 1 and 2: gene sequence variation and functional genomic characterization.
22194612 2012 Competition between sumoylation and ubiquitination of serine hydroxymethyltransferase 1 determines its nuclear localization and its accumulation in the nucleus.
22044939 2012 Impact of SHMT1 polymorphism on the clinical outcome of patients with metastatic colorectal cancer treated with first-line FOLFIRI+bevacizumab.
21987236 2012 Bcl-2/adenovirus E1B 19 kDa-interacting protein 3 (BNIP3) expression is epigenetically regulated by one-carbon metabolism in invasive duct cell carcinoma of breast.
21687976 2012 Polymorphism C1420T of Serine hydroxymethyltransferase gene on maternal risk for Down syndrome.
21269460 2011 Initial characterization of the human central proteome.
21178087 2011 Polymorphisms in serine hydroxymethyltransferase 1 and methylenetetrahydrofolate reductase interact to increase cardiovascular disease risk in humans.
21090237 [Polymorphic variants of folate metabolizing genes (C677T and A1298C MTHFR, C1420T SHMT1 and G1958A MTHFD) are not associated with the risk of breast cancer in West Siberian Region of Russia].
21055808 2011 Polymorphisms in folate-metabolizing genes and risk of non-Hodgkin's lymphoma.
20977478 2010 Analysis of strain-dependent prepulse inhibition points to a role for Shmt1 (SHMT1) in mice and in schizophrenia.
20920350 2010 SHMT1 1420 and MTHFR 677 variants are associated with rectal but not colon cancer.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20852008 2010 Associations of folate, vitamin B12, homocysteine, and folate-pathway polymorphisms with prostate-specific antigen velocity in men with localized prostate cancer.
20842733 2011 Variants in folate pathway genes as modulators of genetic instability and lung cancer risk.
20737570 2010 Genetic variants in one-carbon metabolism-related genes contribute to NSCLC prognosis in a Chinese population.
20670920 2010 Association of genetic variation in cystathionine-beta-synthase and arsenic metabolism.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20615890 2010 A candidate gene study of folate-associated one carbon metabolism genes and colorectal cancer risk.
20544798 2010 Genetic and lifestyle variables associated with homocysteine concentrations and the distribution of folate derivatives in healthy premenopausal women.
20511665 2010 Candidate gene association studies and risk of childhood acute lymphoblastic leukemia: a systematic review and meta-analysis.
20458436 2010 Early-onset ischaemic stroke: analysis of 58 polymorphisms in 17 genes involved in methionine metabolism.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20386493 2010 Polymorphisms within the folate pathway predict folate concentrations but are not associated with disease activity in rheumatoid arthritis patients on methotrexate.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20101025 2010 Genetic variation in the folate metabolic pathway and risk of childhood leukemia.
20031554 2008 Variants of folate metabolism genes and the risk of conotruncal cardiac defects.
19858780 2009 Gene-gene interactions in folate and adenosine biosynthesis pathways affect methotrexate efficacy and tolerability in rheumatoid arthritis.
19777601 2010 Variants of folate metabolism genes and risk of left-sided cardiac defects.
19776626 2008 Polymorphisms in methionine synthase, methionine synthase reductase and serine hydroxymethyltransferase, folate and alcohol intake, and colon cancer risk.
19774638 2010 Pharmacogenomic variations in treatment protocols for childhood acute lymphoblastic leukemia.
19751277 2009 Folate-metabolizing genes in lymphoma patients from Sweden.
19734143 2009 Mechanism of the internal ribosome entry site-mediated translation of serine hydroxymethyltransferase 1.
19707223 2010 No association between cSHMT genotypes and the risk of breast cancer in the Nurses' Health Study.
19706844 2009 Association of folate-pathway gene polymorphisms with the risk of prostate cancer: a population-based nested case-control study, systematic review, and meta-analysis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19619240 2010 The relationship between homocysteine and genes of folate-related enzymes in migraine patients.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19513116 2009 SHMT1 and SHMT2 are functionally redundant in nuclear de novo thymidylate biosynthesis.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19223009 2009 Association analysis of glycine- and serine-related genes in a Japanese population of patients with schizophrenia.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19159907 2009 Methotrexate in pediatric osteosarcoma: response and toxicity in relation to genetic polymorphisms and dihydrofolate reductase and reduced folate carrier 1 expression.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19064578 2008 No association of single nucleotide polymorphisms in one-carbon metabolism genes with prostate cancer risk.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19048631 2009 Oral facial clefts and gene polymorphisms in metabolism of folate/one-carbon and vitamin A: a pathway-wide association study.
19020309 2009 Polymorphisms in folate-related genes and risk of pediatric acute lymphoblastic leukemia.
18996879 2008 Risk of colorectal cancer associated with the C677T polymorphism in 5,10-methylenetetrahydrofolate reductase in Portuguese patients depends on the intake of methyl-donor nutrients.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18635682 2008 Genetic analysis of 56 polymorphisms in 17 genes involved in methionine metabolism in patients with abdominal aortic aneurysm.
18427977 2008 High-throughput multiplex single-nucleotide polymorphism (SNP) analysis in genes involved in methionine metabolism.
18381459 2008 Genetic variation in the one-carbon transfer pathway and ovarian cancer risk.
18378616 2008 Cardiac autonomic dysfunction: effects from particulate air pollution and protection by dietary methyl nutrients and metabolic polymorphisms.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17904392 2008 A high frequency of the MTHFR 677C>T polymorphism in Scottish women with epilepsy: possible role in pathogenesis.
17896178 2008 Polymorphism of cytosolic serine hydroxymethyltransferase, estrogen and breast cancer risk among Chinese women in Taiwan.
17891500 2007 One-carbon metabolism gene polymorphisms and risk of non-Hodgkin lymphoma in Australia.
17595805 Breast cancer risk associated with multigenotypic polymorphisms in folate-metabolizing genes: a nested case-control study in Taiwan.
17482557 2007 Effect of vitamin B6 availability on serine hydroxymethyltransferase in MCF-7 cells.
17446168 2007 Evidence for small ubiquitin-like modifier-dependent nuclear import of the thymidylate biosynthesis pathway.
17420066 2007 Polymorphisms of cytosolic serine hydroxymethyltransferase and risk of lung cancer: a case-control analysis.
17311260 2007 Genetic polymorphisms in the one-carbon metabolism pathway and breast cancer risk: a population-based case-control study and meta-analyses.
17311259 2007 Polymorphisms in one-carbon metabolism and trans-sulfuration pathway genes and susceptibility to bladder cancer.
17206530 2007 Association of MTHFR C677T and SHMT(1) C1420T with susceptibility to ESCC and GCA in a high incident region of Northern China.
17119116 2007 Gene-nutrient interactions among determinants of folate and one-carbon metabolism on the risk of non-Hodgkin lymphoma: NCI-SEER case-control study.
17113224 2007 Dietary intake of B-vitamins, polymorphisms in thymidylate synthase and serine hydroxymethyltransferase 1, and colorectal adenoma risk: a Dutch case-control study.
17074544 2006 Polymorphisms in folate metabolizing genes and risk for spontaneous preterm and small-for-gestational age birth.
17035141 2006 Neural tube defects and folate pathway genes: family-based association tests of gene-gene and gene-environment interactions.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16536979 2006 [Correlations between serine hydroxymethyltransferase1 C1420T polymorphisms and susceptibilities to esophageal squamous cell carcinoma and gastric cardiac adenocarcinoma].
16447238 2006 Risk genotypes in folate-dependent enzymes and their association with methotrexate-related side effects in rheumatoid arthritis.
16365025 2005 Risk of non-Hodgkin lymphoma associated with polymorphisms in folate-metabolizing genes.
16049973 2006 Increased expression of cSHMT, Tbx3 and utrophin in plasma of ovarian and breast cancer patients.
16046727 2005 Polymorphisms in cytoplasmic serine hydroxymethyltransferase and methylenetetrahydrofolate reductase affect the risk of cardiovascular disease in men.
16006999 2005 Polymorphisms and haplotypes of serine hydroxymethyltransferase and risk of squamous cell carcinoma of the head and neck: a case-control analysis.
15797993 2005 Effect of polymorphisms in folate-related genes on in vitro methotrexate sensitivity in pediatric acute lymphoblastic leukemia.
15598699 2005 Low serine hydroxymethyltransferase activity in the human placenta has important implications for fetal glycine supply.
15531579 2005 Mimosine attenuates serine hydroxymethyltransferase transcription by chelating zinc. Implications for inhibition of DNA replication.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15198953 2004 Polymorphisms and haplotypes in folate-metabolizing genes and risk of non-Hodgkin lymphoma.
15122597 2004 Polymorphisms in the one-carbon metabolic pathway, plasma folate levels and colorectal cancer in a prospective study.
15060097 2004 Gene-gene interaction in folate-related genes and risk of neural tube defects in a UK population.
15059614 2004 Low erythrocyte folate status and polymorphic variation in folate-related genes are associated with risk of neural tube defect pregnancy.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14656021 2003 The role of genetic factors in the development of hyperhomocysteinemia.
12615003 2003 Increase of functional diversity by alternative splicing.
12604405 2003 Associations between polymorphisms in the thymidylate synthase and serine hydroxymethyltransferase genes and susceptibility to malignant lymphoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12161434 2002 Cytoplasmic serine hydroxymethyltransferase mediates competition between folate-dependent deoxyribonucleotide and S-adenosylmethionine biosyntheses.
11997338 2002 Genes in a refined Smith-Magenis syndrome critical deletion interval on chromosome 17p11.2 and the syntenic region of the mouse.
11516159 2001 The role of serine hydroxymethyltransferase isozymes in one-carbon metabolism in MCF-7 cells as determined by (13)C NMR.
11386852 2001 Is mutated serine hydroxymethyltransferase (SHMT) involved in the etiology of neural tube defects?
11278996 2001 Heavy chain ferritin enhances serine hydroxymethyltransferase expression and de novo thymidine biosynthesis.
11063567 2000 Structure of a murine cytoplasmic serine hydroxymethyltransferase quinonoid ternary complex: evidence for asymmetric obligate dimers.
10995219 2000 Human cytoplasmic serine hydroxymethyltransferase is an mRNA binding protein.
10549165 1999 Affinity properties of phosvitin: interaction of phosvitin with serine hydroxymethyl transferase.
9753690 1998 The crystal structure of human cytosolic serine hydroxymethyltransferase: a target for cancer chemotherapy.
9573390 1998 Molecular cloning, characterization and alternative splicing of the human cytoplasmic serine hydroxymethyltransferase gene.
9056951 1997 Isolation and characterisation of human genomic sequences encoding cytosolic serine hydroxymethyltransferase.
8786078 1996 Characterisation of a human serine hydroxymethyltransferase pseudogene and its localisation to 1p32.3-33.
8533763 1995 Haploinsufficiency of cytosolic serine hydroxymethyltransferase in the Smith-Magenis syndrome.
8527925 1995 Expression, purification, and characterization of human cytosolic serine hydroxymethyltransferase.
8505317 1993 Cloning of human cDNAs encoding mitochondrial and cytosolic serine hydroxymethyltransferases and chromosomal localization.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
6794659 1981 The role of serine hydroxymethyltransferase in cell proliferation: DNA synthesis from serine following mitogenic stimulation of lymphocytes.
627563 1978 Carnitine biosynthesis. beta-Hydroxylation of trimethyllysine by an alpha-ketoglutarate-dependent mitochondrial dioxygenase.