Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.78
PubTator Score 9.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
pancreatic cancer 1.300 1.4e-02
psoriasis 1.700 7.9e-138
glioblastoma 2.700 1.3e-10
sonic hedgehog group medulloblastoma 2.200 1.4e-05
atypical teratoid/rhabdoid tumor 2.200 1.5e-06
medulloblastoma, large-cell 1.700 1.7e-03
primitive neuroectodermal tumor 2.000 2.4e-03
Atopic dermatitis 1.100 2.4e-02
adrenocortical carcinoma 2.652 4.8e-05
non-small cell lung cancer 1.866 4.5e-25
intraductal papillary-mucinous neoplasm ... 1.600 4.7e-04
colon cancer 1.100 3.4e-02
pediatric high grade glioma 2.700 6.0e-07
pilocytic astrocytoma 1.300 1.4e-04
posterior fossa group A ependymoma 1.600 8.5e-06
pancreatic carcinoma 1.300 1.4e-02
Endometriosis 1.105 2.7e-02
Breast cancer 1.300 1.9e-06
ductal carcinoma in situ 1.200 2.3e-03
invasive ductal carcinoma 1.500 3.1e-03
ulcerative colitis 2.200 5.8e-07
ovarian cancer 1.100 7.2e-03

Gene RIF (4)

PMID Text
25486361 This study gives novel insight into the role of SHCBP in cytokinesis completion.
24289556 Knockdown of SHCBP1 induced cell cycle delay.
23804634 The central region of SHCBP1 was found to bind to measles virus C protein, as well as the phosphoprotein, but the two viral proteins did not compete for SHCBP1 binding.
18976975 Knockdown of SHC SH2-domain binding protein 1 (SHCBP1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MADGSLTGGGLEAAAMAPERMGWAVEQELASLEKGLFQDEDSCSDCSYRDKPGSSLQSFMPEGKTFFPEI      1 - 70
FQTNQLLFYERFRAYQDYILADCKASEVQEFTAEFLEKVLEPSGWRAVWHTNVFKVLVEITDVDFAALKA     71 - 140
VVRLAEPYLCDSQVSTFTMECMKELLDLKEHRLPLQELWVVFDDSGVFDQTALAIEHVRFFYQNIWRSWD    141 - 210
EEEEDEYDYFVRCVEPRLRLHYDILEDRVPSGLIVDYHNLLSQCEESYRKFLNLRSSLSNCNSDSEQENI    211 - 280
SMVEGLKLYSEMEQLKQKLKLIENPLLRYVFGYQKNSNIQAKGVRSSGQKITHVVSSTMMAGLLRSLLTD    281 - 350
RLCQEPGEEEREIQFHSDPLSAINACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEKRGKG    351 - 420
DTFVDCTGADIKISGIKFVQHDAVEGILIVHRGKTTLENCVLQCETTGVTVRTSAEFLMKNSDLYGAKGA    421 - 490
GIEIYPGSQCTLSDNGIHHCKEGILIKDFLDEHYDIPKISMVNNIIHNNEGYGVVLVKPTIFSDLQENAE    491 - 560
DGTEENKALKIQTSGEPDVAERVDLEELIECATGKMELCARTDPSEQVEGNCEIVNELIAASTQKGQIKK    561 - 630
KRLSELGITQADDNLMSQEMFVGIVGNQFKWNGKGSFGTFLF                                631 - 672
//

Text Mined References (29)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25486361 2014 SHCBP1 is required for midbody organization and cytokinesis completion.
24289556 2013 Targeting SHCBP1 inhibits cell proliferation in human hepatocellular carcinoma cells.
23804634 2013 Measles virus nonstructural C protein modulates viral RNA polymerase activity by interacting with host protein SHCBP1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21187330 2010 Nessun Dorma, a novel centralspindlin partner, is required for cytokinesis in Drosophila spermatocytes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10086341 1999 Cloning and characterization of mPAL, a novel Shc SH2 domain-binding protein expressed in proliferating cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.