Property Summary

Ligand Count 110
NCBI Gene PubMed Count 272
PubMed Score 5097.23
PubTator Score 4044.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Seborrheic dermatitis 31
Acne vulgaris 15
Acquired thrombocytopenia 8
Acute lymphoid leukemia 25
Adrenal cortical hypofunction 23
Adrenogenital disorder 6
Advanced Prostatic Carcinoma 5
Allergic conjunctivitis 22
Allergic rhinitis 95
Amenorrhea Secondary to Ovarian Dysfunction 8
Anemia in chronic kidney disease 4
Anemia of chronic renal failure 4
Angioedema 38
Ankylosing spondylitis 140
Aphthous ulcer of mouth 7
Articular gout 11
Aspiration pneumonitis 6
Asthma 385
Atopic dermatitis 952
Atrophic vaginitis 14
Atrophic vulva 6
Autoimmune disease 5
Autoimmune hemolytic anemia 31
Bacterial keratitis 5
Berylliosis 28
Bilateral Anorchia 3
Bilateral orchidectomy 3
Blepharoconjunctivitis 5
Bursitis 10
Catabolic Process 2
Cerebral Edema 30
Chemotherapy-Induced Hypogonadism 3
Chemotherapy-induced nausea and vomiting 18
Chronic ulcerative proctitis 7
Congenital adrenal hyperplasia 73
Congenital hypoplastic anemia 8
Contact Dermatitis 81
Contraception 15
Corneal Ulcer 21
Corneal abrasion 5
Corpus Luteum Insufficiency Syndrome 8
Crohn's disease 321
Cyclitis 5
Deficiency of testosterone biosynthesis 6
Delayed Puberty 97
Dermatitis herpetiformis 12
Diagnostic Test for Cushing's Syndrome 5
Discoid lupus erythematosus 7
Disorder of eye 27
Disorder of musculoskeletal system 5
Disorder of skin 5
Dysfunctional uterine bleeding 9
Dyspareunia 12
Edema of larynx 5
Endometrial Hyperplasia Prevention 9
Endometrial carcinoma 15
Endometriosis 540
Epicondylitis 22
Eruption of skin 5
Erythema multiforme 17
Erythroblastic Anemia 5
Erythroderma 5
Female hypogonadism syndrome 25
Fibrocystic breast changes 3
Follicular non-Hodgkin's lymphoma 17
Gingival Disorders 3
Granuloma annulare 5
Hemorrhoids 13
Hereditary Angioedema Prevention 3
Herpes zoster keratitis 5
Hodgkin's disease 18
Hormone receptor positive malignant neoplasm of breast 10
Humoral hypercalcemia of malignancy 6
Hypogonadotropic hypogonadism 89
Hypopituitarism 40
Idiopathic thrombocytopenic purpura 5
Infection by larvae of Trichinella spiralis 3
Infective blepharitis 5
Infective otitis externa 4
Infertility Secondary to Progesterone Deficiency 8
Inflammatory bowel disease 151
Inflammatory dermatosis 3
Inhibition of lactation procedure 3
Iridocyclitis 19
Iritis 8
Itching of ear 3
Juvenile rheumatoid arthritis 111
Keratitis 62
Klinefelter's syndrome, XXY 3
LHRH Deficiency 3
Lichen simplex chronicus 7
Löffler's syndrome 5
Male hypogonadism 3
Malignant otitis externa due to Pseudomonas aeruginosa 4
Mastoidectomy Cavity Infections 3
Menopausal flushing 17
Menorrhagia 25
Metastatic Breast Carcinoma 21
Metastatic Prostate Carcinoma 18
Miliary tuberculosis 6
Minor Bacterial Skin Infections 3
Multiple Sclerosis 540
Mycosis fungoides 29
Nephrotic Syndrome 78
Non-Hodgkin's lymphoma 22
Otitis externa 10
Pemphigus 23
Plaque psoriasis 17
Post traumatic osteoarthritis 5
Post-Op Ocular Inflammation 9
Postcoital contraception 2
Postmenopausal osteoporosis 19
Premenstrual dysphoric disorder 8
Prevention of Post-Operative Nausea and Vomiting 14
Prevention of Premature Labor 9
Prevention of Radiation-Induced Nausea and Vomiting 7
Primary Hypogonadism due to Bilateral Torsion 3
Primary Hypogonadism due to Orchitis 3
Primary adrenocortical insufficiency 6
Primary cutaneous T-cell lymphoma 29
Primary ovarian failure 5
Proctitis 13
Pruritus ani 14
Pruritus of genital organs 5
Psoriasis with arthropathy 11
Punctate keratopathy 5
Recurrent herpes simplex labialis 3
Rheumatic heart disease 10
Rheumatoid arthritis 1191
Rosacea 25
Scalp psoriasis 6
Secondary malignant neoplasm of kidney 9
Secondary physiologic amenorrhea 32
Severe adrenal insufficiency 5
Staphylococcus Aureus Otitis Externa 4
Superficial Ocular Infection 6
Synovitis 78
Synovitis due to Osteoarthritis 5
Systemic Dermatomyositis 5
Systemic lupus erythematosus 194
Tendinitis 14
Tenosynovitis 14
Thyroiditis 29
Tinea corporis 25
Tinea cruris 12
Tinea pedis 29
Transfusion Reaction Urticaria 5
Transfusion reaction due to serum protein reaction 5
Transplanted organ rejection 10
Undescended testicle 3
Urethral atrophy 4
Uveitis 103
psoriasis 6694
sarcoidosis 370
ulcerative colitis 1819
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 3.0
Prostate cancer 175 0.0 3.0

Expression

Gene RIF (275)

AA Sequence

MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTS      1 - 70
SSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDS     71 - 140
VLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASA    141 - 210
PTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLH    211 - 280
LQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLG    281 - 350
ALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH                      351 - 402
//

Text Mined References (274)

PMID Year Title