Property Summary

NCBI Gene PubMed Count 34
PubMed Score 169.65
PubTator Score 54.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
active ulcerative colitis 1.493 2.3e-02
group 3 medulloblastoma 1.400 2.1e-02
interstitial cystitis -1.200 1.1e-03
invasive ductal carcinoma 1.100 2.7e-02
ovarian cancer -1.500 1.7e-04
psoriasis 1.200 7.1e-04

Gene RIF (8)

AA Sequence

MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSL      1 - 70
PDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCC     71 - 140
CASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYISPKHRLIKVESAAGGGAGDPLGGACAGGRTW    141 - 210
SPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTE    211 - 280
FQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPAL    281 - 350
AAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDA    351 - 420
ENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKL    421 - 490
PIKGAEHLSLLYPVAVRTL                                                       491 - 509
//

Text Mined References (41)

PMID Year Title