Property Summary

NCBI Gene PubMed Count 17
PubMed Score 60.09
PubTator Score 24.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
23644744 We found a genome-wide significant association for rs2282987 in CDK6 and a consistent association for rs2706748 in SH3RF1 .
21841072 ALIX is an ubiquitination substrate of the ubiquitin E3-ligase POSH and POSH and ALIX cooperate to facilitate efficient HIV-1 release, suggesting the interaction between HIV-1 Gag and POSH and POSH may be functionally auxiliary for viral release
21586138 The data presented here define POSH and Siah2 as important mediators of death receptor mediated apoptosis and suggest targeting the interaction of these two E3 ligases is a promising novel cancer therapeutic strategy.
20974134 POSH promotes cell survival in Drosophila and in human rheumatoid arthritis synovial fibroblasts
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19710010 POSH inhibits ROMK channels by enhancing dynamin-dependent and clathrin-independent endocytosis and by stimulating ubiquitination of ROMK channels.
19393081 Results identified ALIX as an ubiquitination substrate of POSH and indicate that POSH and ALIX cooperate to facilitate efficient virus release.
19393081 ALIX is an ubiquitination substrate of the ubiquitin E3-ligase POSH and POSH and ALIX cooperate to facilitate efficient HIV-1 release, suggesting the interaction between HIV-1 Gag and POSH and POSH may be functionally auxiliary for viral release
15659549 A previously undescribed step in HIV biogenesis that suggests a direct function for hPOSH-mediated ubiquitination in protein sorting at the trans-Golgi network.
14504284 POSH disassociates from the JNK complex after phosphorylation of MLK3 by Akt2, which leads to down-regulation of the JNK signaling pathway
9482736 This publication pertains to studies in mice.

AA Sequence

MDESALLDLLECPVCLERLDASAKVLPCQHTFCKRCLLGIVGSRNELRCPECRTLVGSGVEELPSNILLV      1 - 70
RLLDGIKQRPWKPGPGGGSGTNCTNALRSQSSTVANCSSKDLQSSQGGQQPRVQSWSPPVRGIPQLPCAK     71 - 140
ALYNYEGKEPGDLKFSKGDIIILRRQVDENWYHGEVNGIHGFFPTNFVQIIKPLPQPPPQCKALYDFEVK    141 - 210
DKEADKDCLPFAKDDVLTVIRRVDENWAEGMLADKIGIFPISYVEFNSAAKQLIEWDKPPVPGVDAGECS    211 - 280
SAAAQSSTAPKHSDTKKNTKKRHSFTSLTMANKSSQASQNRHSMEISPPVLISSSNPTAAARISELSGLS    281 - 350
CSAPSQVHISTTGLIVTPPPSSPVTTGPSFTFPSDVPYQAALGTLNPPLPPPPLLAATVLASTPPGATAA    351 - 420
AAAAGMGPRPMAGSTDQIAHLRPQTRPSVYVAIYPYTPRKEDELELRKGEMFLVFERCQDGWFKGTSMHT    421 - 490
SKIGVFPGNYVAPVTRAVTNASQAKVPMSTAGQTSRGVTMVSPSTAGGPAQKLQGNGVAGSPSVVPAAVV    491 - 560
SAAHIQTSPQAKVLLHMTGQMTVNQARNAVRTVAAHNQERPTAAVTPIQVQNAAGLSPASVGLSHHSLAS    561 - 630
PQPAPLMPGSATHTAAISISRASAPLACAAAAPLTSPSITSASLEAEPSGRIVTVLPGLPTSPDSASSAC    631 - 700
GNSSATKPDKDSKKEKKGLLKLLSGASTKRKPRVSPPASPTLEVELGSAELPLQGAVGPELPPGGGHGRA    701 - 770
GSCPVDGDGPVTTAVAGAALAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLNESRPVVCERHRVVVSY    771 - 840
PPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI                          841 - 888
//

Text Mined References (25)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23644744 2013 Imputation-based association analyses identify new lung cancer susceptibility variants in CDK6 and SH3RF1 and their interactions with smoking in Chinese populations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21586138 2011 Possible role of death receptor-mediated apoptosis by the E3 ubiquitin ligases Siah2 and POSH.
20974134 2010 POSH promotes cell survival in Drosophila and in human RASF cells.
20936779 2010 A human MAP kinase interactome.
20696164 2010 POSH2 is a RING finger E3 ligase with Rac1 binding activity through a partial CRIB domain.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19710010 2009 POSH stimulates the ubiquitination and the clathrin-independent endocytosis of ROMK1 channels.
19393081 2009 Exploring the functional interaction between POSH and ALIX and the relevance to HIV-1 release.
17535800 2007 Regulation of the Pro-apoptotic scaffolding protein POSH by Akt.
17420289 2007 The ubiquitin E3 ligase POSH regulates calcium homeostasis through spatial control of Herp.
16571722 2006 Direct interaction of the molecular scaffolds POSH and JIP is required for apoptotic activation of JNKs.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16230351 2006 Siah1 interacts with the scaffold protein POSH to promote JNK activation and apoptosis.
15659549 2005 The trans-Golgi network-associated human ubiquitin-protein ligase POSH is essential for HIV type 1 production.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14504284 2003 Akt2 negatively regulates assembly of the POSH-MLK-JNK signaling complex.
12514131 2003 POSH acts as a scaffold for a multiprotein complex that mediates JNK activation in apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9482736 1998 A new rac target POSH is an SH3-containing scaffold protein involved in the JNK and NF-kappaB signalling pathways.