Property Summary

NCBI Gene PubMed Count 85
PubMed Score 60.60
PubTator Score 68.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
astrocytic glioma -1.300 1.6e-03
posterior fossa group A ependymoma -2.100 5.8e-12
oligodendroglioma -1.300 3.9e-03
osteosarcoma -1.667 2.1e-03
group 4 medulloblastoma -2.900 3.0e-06
atypical teratoid / rhabdoid tumor -1.900 6.4e-05
glioblastoma -1.400 2.5e-03
medulloblastoma, large-cell -2.700 3.4e-05
primitive neuroectodermal tumor -1.400 1.3e-02
Atopic dermatitis -1.200 2.3e-03
primary pancreatic ductal adenocarcinoma 1.626 3.6e-04
tuberculosis 1.100 6.5e-09
non-small cell lung cancer -1.184 3.2e-20
intraductal papillary-mucinous adenoma (... 1.800 1.2e-02
intraductal papillary-mucinous carcinoma... 1.900 2.8e-02
intraductal papillary-mucinous neoplasm ... 2.900 1.0e-02
pancreatic cancer 1.700 3.3e-04
breast carcinoma -1.100 2.3e-03
fibroadenoma -1.300 3.6e-02
interstitial cystitis 1.100 1.5e-03
adult high grade glioma -1.200 1.0e-02
primary Sjogren syndrome 1.200 4.2e-02
gastric carcinoma 1.200 2.4e-02
invasive ductal carcinoma -1.600 8.2e-04
acute myeloid leukemia 1.600 4.7e-02
ovarian cancer 1.500 4.4e-04

Gene RIF (43)

PMID Text
26169354 CIN85 promotes recycling of TGF-beta receptors and thereby positively regulates TGF-beta signaling.
25816594 Multiple molecular forms of adaptor protein Ruk/CIN85 specifically associate with different subcellular compartments in human breast adenocarcinoma cell line.
25496667 Genome-wide shRNA screening identifies SH3KBP1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25472714 we demonstrate that SEPT9 negatively regulates EGFR degradation by preventing the association of the ubiquitin ligase Cbl with CIN85, resulting in reduced EGFR ubiquitylation
25449262 Results support the model that Cbl-CIN85-endophilin complex is not required for efficient internalization of EGFR, a prototype RTK.
24167568 LOX-PP interacts with CIN85 via a novel SH3-binding motif and this association reduces CIN85-promoted invasion by breast cancer cells.
23279575 an FRS2beta-CIN85/CD2AP-Cbl axis for downregulation of ErbB2 may regulate ErbB2 protein levels in physiological and pathological settings
22833562 Data show that EGFR activation leads to a pronounced src-mediated tyrosine phosphorylation of CIN85 that subsequently influences EGFR ubiquitination.
22791810 this study indicates that high levels of Ruk(l)/CIN85 contribute to the conversion of breast adenocarcinoma cells into a more malignant phenotype via modulation of the Src/Akt pathway.
22262777 Data show that CIN85 (c-Cbl interacting protein of 85 kDa) is constitutively associated with c-Cbl, Cbl-b, and B-cell linker in B cells.
21822214 Live cell imaging and co-immunoprecipitation experiments confirmed that both SLP65 and CIN85 are both required for the onset and progression phases of B-cell antigen receptor signal transduction.
21635887 The CIN85 was constitutively associated with Hrs, and this strengthens the hypothesis of a functional role of CIN85 in endosomal EGFR sorting.
21446695 the N- and C-termini are important for the structure, stability, and function of the third SH3 domain of CIN85
21372129 the ubiquitination and degradation of stimulated FcgammaRIIa mediated by c-Cbl are positively regulated by the adaptor protein CIN85 in a PKC-dependent manner and these events contribute to the termination of FcgammaRIIa signaling.
21275903 ARAP1 associated with CIN85 affects epidermal growth factor receptor endocytic trafficking.
20927317 High CIN85 is associated with the development and progression of head and neck squamous cell carcinoma.
20457601 Coexpression of CIN85/Ruk(L) with CD2AP led to a decreased binding of CIN85/Ruk(L) to nephrin and podocin, which indicates a functional competition between CD2AP and CIN85/Ruk(L).
20221403 CIN85 binding to a C-terminal motif within hTTP leads to the increased phosphorylation of hTTP, possibly through enhanced association with MEKK4
20216986 Ruk/CIN85 induces PAI-1 expression via modulation of HIF-1alpha stability
20130058 The ORF3 protein of hepatitis E virus was found to interact with CIN85 and compete with the formation of the growth factor receptor-Cbl-CIN85 complex, resulting in the reduced ubiquitination of CIN85.
19268472 detailed high-resolution solution structural study of CIN85A and CIN85B binding to proline-arginine peptides derived from the cognate ligands Cbl and Cbl-b
19166927 Epidermal Growth Factor stimulation increases association of Cbl and Ruk/CIN85, which is dependent on tyrosine phosphorylation of the C-terminal region of Proto-Oncogene Proteins Cbl.
18680311 Results suggest that competition between Cbl and ubiquitin binding to CIN85 regulates Cbl function and EGFR endocytosis.
18266907 These results suggest that endogenous Ruk/CIN85 may be involved in regulation of specific membrane trafficking processes.
18048363 H-Ras interacts with Spry2-binding partners, c-Cbl and CIN85, in a Spry2-dependent manner.
17823309 identified a polyproline-arginine sequence in the pTalpha cytoplasmic tail that interacted in vitro with SH3 domains of the CIN85/CMS family of adaptors, and mediated the recruitment of multiprotein complexes involving all (CMS, CIN85, and CD2BP3) members
17675467 a new role for CIN85 in regulating Syk protein levels in RBL-2H3 cells through the activation of the ubiquitin-proteasome pathway and provide a mechanism for this regulation involving c-Cbl ligase activity.
17606992 CIN85 is expressed as multiple isoforms that share the coiled-coil domain, suggesting that heterotypic interactions with CMS provides a mechanism to regulate CMS binding to F-actin and thus for modulating dynamic rearrangements of the cytoskeleton.
17306257 unexpected role of 3BP2 in endocytic and cytoskeletal regulation through its interaction with CIN85 and HIP-55
17255943 CIN85, a Cbl-interacting protein, is a component of AMAP1-mediated breast cancer invasion machinery.
16895919 CFBP is a novel tyrosine-phosphorylated protein that might function as a regulator of CIN85/CD2AP
16256071 Taken together, these results indicate a novel role for CIN85 in the regulation of cellular stress response via the MAPK pathways.
16223483 CIN85 might play an important role in HSV-1 infection.
15824310 Data show that infected cell protein 0 (ICP0) binds CIN85 in a reciprocal manner and that the complexes pulled down by ICP0 also contain Cbl.
15707590 CIN85 (SH3-domain kinase binding protein 1) associates with TNF receptor 1 via Src and modulates TNF-alpha-induced apoptosis.
14596919 CIN85 association with Dab2 is essential for its recruitment to clathrin coat and appears to be modulated by growth factor stimulation
12946264 forms complexes with endonucleases in HEK293 cells
12771190 adaptor protein SETA (CIN85) and its binding partner AIP1 are involved with the cytoskeleton and in the regulation of cell adhesion
12690097 Cd2 antigen is linked to CAPZ via this protein and CMS.
12218189 Cbl-directed monoubiquitination of CIN85 is involved in regulation of ligand-induced degradation of EGF receptors.
12177062 CIN85 participates in Cbl-b-mediated down-regulation of receptor tyrosine kinases
11894096 The endophilin-CIN85-Cbl complex mediates ligand-dependent downregulation of c-Met
11894095 Cbl-CIN85-endophilin complex mediates ligand-induced downregulation of EGF receptors

AA Sequence

MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEMKKDPLTNKAP      1 - 70
EKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVL     71 - 140
NGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKV    141 - 210
KGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEA    211 - 280
QNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQ    281 - 350
GAGTTERKHEIKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPR    351 - 420
RPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPTTSRPKATGRR    421 - 490
PPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTISQVSDNKASLPPKPGTMAAGG    491 - 560
GGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKPKMEPAASSQAAVEELRTQVRELRSIIETMKDQQ    561 - 630
KREIKQLLSELDEEKKIRLRLQMEVNDIKKALQSK                                       631 - 665
//

Text Mined References (95)

PMID Year Title
26169354 2015 CIN85 modulates TGF? signaling by promoting the presentation of TGF? receptors on the cell surface.
25816594 Multiple molecular forms of adaptor protein Ruk/CIN85 specifically associate with different subcellular compartments in human breast adenocarcinoma MCF-7 cells.
25472714 2015 SEPT9 negatively regulates ubiquitin-dependent downregulation of EGFR.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25449262 2014 Cbl-family ubiquitin ligases and their recruitment of CIN85 are largely dispensable for epidermal growth factor receptor endocytosis.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24167568 2013 Inhibition of CIN85-mediated invasion by a novel SH3 domain binding motif in the lysyl oxidase propeptide.
23663663 2013 Multimeric and differential binding of CIN85/CD2AP with two atypical proline-rich sequences from CD2 and Cbl-b*.
23279575 2013 Adaptor protein complex of FRS2? and CIN85/CD2AP provides a novel mechanism for ErbB2/HER2 protein downregulation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178720 2013 Dab1 stabilizes its interaction with Cin85 by suppressing Cin85 phosphorylation at serine 587.
22833562 2012 CIN85 phosphorylation is essential for EGFR ubiquitination and sorting into multivesicular bodies.
22791810 2012 Increased levels of the HER1 adaptor protein Rukl/CIN85 contribute to breast cancer malignancy.
22262777 2012 CIN85 is required for Cbl-mediated regulation of antigen receptor signaling in human B cells.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
21822214 2011 The B-cell antigen receptor signals through a preformed transducer module of SLP65 and CIN85.
21635887 2011 CIN85 regulates ubiquitination and degradative endosomal sorting of the EGF receptor.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21446695 2011 Making ends meet: the importance of the N- and C-termini for the structure, stability, and function of the third SH3 domain of CIN85.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21372129 2011 CIN85 modulates the down-regulation of Fc gammaRIIa expression and function by c-Cbl in a PKC-dependent manner in human neutrophils.
21275903 2011 ARAP1 association with CIN85 affects epidermal growth factor receptor endocytic trafficking.
21269460 2011 Initial characterization of the human central proteome.
20927317 2010 A critical role of c-Cbl-interacting protein of 85 kDa in the development and progression of head and neck squamous cell carcinomas through the ras-ERK pathway.
20711168 2010 A Dyn2-CIN85 complex mediates degradative traffic of the EGFR by regulation of late endosomal budding.
20551902 2010 CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice.
20457601 2010 CIN85/RukL is a novel binding partner of nephrin and podocin and mediates slit diaphragm turnover in podocytes.
20221403 2010 Phosphorylation of human tristetraprolin in response to its interaction with the Cbl interacting protein CIN85.
20216986 2010 The adaptor protein Ruk/CIN85 activates plasminogen activator inhibitor-1 (PAI-1) expression via hypoxia-inducible factor-1alpha.
20130058 2010 The ORF3 protein of hepatitis E virus delays degradation of activated growth factor receptors by interacting with CIN85 and blocking formation of the Cbl-CIN85 complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19268472 2009 Novel insights into the mechanisms of CIN85 SH3 domains binding to Cbl proteins: solution-based investigations and in vivo implications.
19166927 2009 Intersectin 1 forms a complex with adaptor protein Ruk/CIN85 in vivo independently of epidermal growth factor stimulation.
19111555 2009 Alternate binding modes for a ubiquitin-SH3 domain interaction studied by NMR spectroscopy.
18680311 2008 Interactions between the three CIN85 SH3 domains and ubiquitin: implications for CIN85 ubiquitination.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18266907 2008 Adaptor protein Ruk/CIN85 is associated with a subset of COPI-coated membranes of the Golgi complex.
18048363 2008 Evidence that sprouty 2 is necessary for sarcoma formation by H-Ras oncogene-transformed human fibroblasts.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17823309 2007 Identification of CMS as a cytosolic adaptor of the human pTalpha chain involved in pre-TCR function.
17675467 2007 The adaptor molecule CIN85 regulates Syk tyrosine kinase level by activating the ubiquitin-proteasome degradation pathway.
17606992 2007 Structure and function analysis of the CMS/CIN85 protein family identifies actin-bundling properties and heterotypic-complex formation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17306257 2007 Abl-SH3 binding protein 2, 3BP2, interacts with CIN85 and HIP-55.
17255943 2007 CIN85, a Cbl-interacting protein, is a component of AMAP1-mediated breast cancer invasion machinery.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16895919 2006 CFBP is a novel tyrosine-phosphorylated protein that might function as a regulator of CIN85/CD2AP.
16751601 2006 CIN85 is localized at synapses and forms a complex with S-SCAM via dendrin.
16678097 2006 A Rich1/Amot complex regulates the Cdc42 GTPase and apical-polarity proteins in epithelial cells.
16256071 2005 CIN85 regulates the ability of MEKK4 to activate the p38 MAP kinase pathway.
16228008 2005 Cbl promotes clustering of endocytic adaptor proteins.
16223483 2005 Overexpression of CIN85 suppresses the growth of herpes simplex virus in HeLa cells.
16177060 2005 CIN85 regulates the ligand-dependent endocytosis of the IgE receptor: a new molecular mechanism to dampen mast cell function.
16164598 2005 Rho mediates endocytosis of epidermal growth factor receptor through phosphorylation of endophilin A1 by Rho-kinase.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15962011 2005 Sprouty2 acts at the Cbl/CIN85 interface to inhibit epidermal growth factor receptor downregulation.
15824310 2005 Herpes simplex virus 1 infected cell protein 0 forms a complex with CIN85 and Cbl and mediates the degradation of EGF receptor from cell surfaces.
15772651 2005 The DNA sequence of the human X chromosome.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15719014 2005 Expression of AMAP1, an ArfGAP, provides novel targets to inhibit breast cancer invasive activities.
15707590 2005 CIN85 associates with TNF receptor 1 via Src and modulates TNF-alpha-induced apoptosis.
15557335 2005 Src phosphorylation of Alix/AIP1 modulates its interaction with binding partners and antagonizes its activities.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456872 2004 Alix/AIP1 antagonizes epidermal growth factor receptor downregulation by the Cbl-SETA/CIN85 complex.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15147912 2004 Identification and characterization of a novel Rho GTPase activating protein implicated in receptor-mediated endocytosis.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15090612 2004 CIN85 associates with multiple effectors controlling intracellular trafficking of epidermal growth factor receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14596919 2003 Dab2 links CIN85 with clathrin-mediated receptor internalization.
12946264 2003 Adaptor protein Ruk1 forms protein-protein complexes with endonuclease activity in HEK293 cells.
12874286 2003 Identification of a novel proline-arginine motif involved in CIN85-dependent clustering of Cbl and down-regulation of epidermal growth factor receptors.
12829691 2003 Atypical recognition consensus of CIN85/SETA/Ruk SH3 domains revealed by target-assisted iterative screening.
12771190 2003 SETA/CIN85/Ruk and its binding partner AIP1 associate with diverse cytoskeletal elements, including FAKs, and modulate cell adhesion.
12734385 2003 Epidermal growth factor receptor signaling intensity determines intracellular protein interactions, ubiquitination, and internalization.
12690097 2003 Linking the T cell surface protein CD2 to the actin-capping protein CAPZ via CMS and CIN85.
12618476 2003 CD2BP3, CIN85 and the structurally related adaptor protein CMS bind to the same CD2 cytoplasmic segment, but elicit divergent functional activities.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12218189 2002 Cbl-directed monoubiquitination of CIN85 is involved in regulation of ligand-induced degradation of EGF receptors.
12177062 2002 CIN85 participates in Cbl-b-mediated down-regulation of receptor tyrosine kinases.
12135478 2002 Ruk is ubiquitinated but not degraded by the proteasome.
12029088 2002 Identification of novel SH3 domain ligands for the Src family kinase Hck. Wiskott-Aldrich syndrome protein (WASP), WASP-interacting protein (WIP), and ELMO1.
11894096 2002 The endophilin-CIN85-Cbl complex mediates ligand-dependent downregulation of c-Met.
11894095 2002 Cbl-CIN85-endophilin complex mediates ligand-induced downregulation of EGF receptors.
11474197 2001 Assignment of SH3KBP1 to human chromosome band Xp22.1-->p21.3 by in situ hybridization.
11071869 2000 Characterization of the CIN85 adaptor protein and identification of components involved in CIN85 complexes.
10921882 2000 Negative regulation of PI 3-kinase by Ruk, a novel adaptor protein.
10679202 2000 Cloning and characterization of a novel adaptor protein, CIN85, that interacts with c-Cbl.
9507006 1998 Identification of sirm, a novel insulin-regulated SH3 binding protein that associates with Grb-2 and FYN.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.