Property Summary

NCBI Gene PubMed Count 20
PubMed Score 4.61
PubTator Score 5.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis -1.400 4.4e-02
esophageal adenocarcinoma -1.100 1.8e-02
cutaneous lupus erythematosus -1.100 4.4e-04
psoriasis -2.000 8.7e-04
glioblastoma -1.300 2.9e-02
oligodendroglioma -1.100 1.4e-13
osteosarcoma -1.251 4.1e-08
astrocytoma -1.500 9.1e-03
atypical teratoid / rhabdoid tumor -1.100 4.9e-07
interstitial cystitis -2.000 8.7e-04
adult high grade glioma -1.500 5.9e-03
group 3 medulloblastoma -1.400 4.0e-02
subependymal giant cell astrocytoma -2.428 5.0e-03
Pick disease -1.600 3.7e-04
pterygium -1.200 1.6e-02

Gene RIF (3)

PMID Text
23921385 the potential importance of the endophilin B2-plectin complex in the biological functions depending on nuclear migration and positioning.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18303116 identified a nonmutated HLA-A2-binding epitope in the human ortholog SH3GLB2, which primed T cells from healthy HLA-A2(+) individuals

AA Sequence

MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSA      1 - 70
RVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISF     71 - 140
LTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALW    141 - 210
NDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGR    211 - 280
FPGTFVGTTEPASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAAD    281 - 350
SSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS                             351 - 395
//

Text Mined References (23)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
23921385 2013 The Bin/amphiphysin/Rvs (BAR) domain protein endophilin B2 interacts with plectin and controls perinuclear cytoskeletal architecture.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
21266059 2011 Tumor-suppressor activity of RRIG1 in breast cancer.
20562859 2010 Network organization of the human autophagy system.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18303116 2008 SPAS-1 (stimulator of prostatic adenocarcinoma-specific T cells)/SH3GLB2: A prostate tumor antigen identified by CTLA-4 blockade.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16849557 2006 RRIG1 mediates effects of retinoic acid receptor beta2 on tumor cell growth and gene expression through binding to and inhibition of RhoA.
16518874 2006 Landscape of the hnRNP K protein-protein interactome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
11161816 2001 SH3GLB, a new endophilin-related protein family featuring an SH3 domain.