Property Summary

NCBI Gene PubMed Count 45
PubMed Score 4.54
PubTator Score 22.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.061 1.3e-02
Multiple myeloma 1.454 7.2e-04
malignant mesothelioma -1.700 1.2e-07
glioblastoma 2.600 8.2e-05
osteosarcoma 1.369 1.6e-03
ependymoma 1.400 6.7e-13
lung cancer -1.300 9.6e-03
Breast cancer 2.900 3.4e-02
pediatric high grade glioma 1.700 3.7e-07
pilocytic astrocytoma 1.200 1.2e-06
sonic hedgehog group medulloblastoma 1.100 3.7e-06
ductal carcinoma in situ -1.100 1.0e-03
invasive ductal carcinoma -1.600 1.0e-03
ovarian cancer -2.800 4.3e-12
Down syndrome 1.200 7.3e-04

Gene RIF (20)

PMID Text
25981964 Our findings suggest that endophilin-B1 is a key mediator of a feed-forward mechanism of Alzheimer's disease pathogenesis
25619828 these data reveal an Irgm1-dependent mechanism that promotes the tumorigenesis of melanoma via dual regulation of apoptosis and Bif-1-dependent autophagy
23429496 Data suggest that activated autophagy is associated with the progression of pancreatic ductal adenocarcinoma and that the overexpression of autophagy-related proteins Atg5, Ambra1, beclin-1, LC3B and Bif-1 is significantly correlated with poor outcome.
22785202 these data suggest a novel function for Bif-1 as a suppressor of breast cancer cell migration by promoting EGFR degradation through the regulation of endosome maturation
21283040 The expression of Bif-1 is downregulated in a subset of pancreatic ductal adenocarcinoma. This novel finding is in agreement with the tumor suppressor function of Bif-1.
21068542 These findings suggest that Bif-1 acts as a critical regulator of Atg9 puncta formation presumably by mediating Golgi fission for autophagosome biogenesis during starvation.
20159967 GSK-3beta promotes cell survival by modulating Bif-1-dependent autophagic response and cell death.
19805544 Bax activates endophilin B1 oligomerization and lipid membrane vesiculation
19132989 Deregulation of Bif-1-related cell death is dependent not on Bif-1 mutation but on other mechanisms.
19132989 Observational study of gene-disease association. (HuGE Navigator)
19125733 upregulation of Bif-1 could in part be responsible for tumorigenesis in cutaneous Merkel cell carcinoma
19074440 DLP1 also caused global morphological changes in mitochondrial outer membrane-like liposomes, but DLP1 did not stimulate BAX-permeabilizing function in the absence or presence of Bif-1.
18833585 down-regulation of Bif-1 during the transition from normal colorectal mucosa to colorectal adenocarcinoma
18824435 The loss of Bif-1 expression in a subset of prostate cancer samples is in agreement with the proapoptotic function of Bif-1.
18752120 Bif-1 expression might play a role in tumorigenesis in both urinary bladder (UB) and gallbladder (GB) cancer
18474606 Src phosphorylation of Bif-1 suppresses the interaction between Bif-1 and Bax, resulting in the inhibition of Bax activation during anoikis.
16916719 The decreased expression of Bif-1 in malignant gastric epithelial cells compared with the normal mucosal cells suggests that loss of Bif-1 expression may play a role in gastric tumorigenesis, possibly by inhibiting the apoptosis mediated by Bif-1.
16763557 BAR domain of endophilin-A1 drives membrane curvature by coordinate action of the crescent's scaffold mechanism and the ridge's membrane insertion in addition to membrane binding via amino-terminal amphipathic helix.
16227588 Bif-1 is an important component of the mitochondrial pathway for apoptosis as a novel Bax/Bak activator, and loss of this proapoptotic molecule may contribute to tumorigenesis.
15452144 Double knockdown of endophilin B1 and Drp1 leads to a mitochondrial phenotype identical to that of the Drp1 single knockdown, a result consistent with Drp1 acting upstream of endophilin B1 in the maintenance of morphological dynamics of mitochondria.

AA Sequence

MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPN      1 - 70
PNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSA     71 - 140
LNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITR    141 - 210
LLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIG    211 - 280
SSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERG    281 - 350
NQKGKVPITYLELLN                                                           351 - 365
//

Text Mined References (49)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25981964 2015 Loss of endophilin-B1 exacerbates Alzheimer's disease pathology.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25619828 2015 IFNg-induced Irgm1 promotes tumorigenesis of melanoma via dual regulation of apoptosis and Bif-1-dependent autophagy.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24056303 2013 PtdIns(3)P-bound UVRAG coordinates Golgi-ER retrograde and Atg9 transport by differential interactions with the ER tether and the beclin 1 complex.
23429496 2013 Prognostic significance of autophagy-related protein expression in resected pancreatic ductal adenocarcinoma.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22785202 2012 Bif-1 suppresses breast cancer cell migration by promoting EGFR endocytic degradation.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21499257 2011 Cdk5-mediated phosphorylation of endophilin B1 is required for induced autophagy in models of Parkinson's disease.
21283040 2011 Down-regulation of Bax-interacting factor 1 in human pancreatic ductal adenocarcinoma.
21269460 2011 Initial characterization of the human central proteome.
21068542 2011 Bif-1 regulates Atg9 trafficking by mediating the fission of Golgi membranes during autophagy.
20643123 2010 A phosphatidylinositol 3-kinase class III sub-complex containing VPS15, VPS34, Beclin 1, UVRAG and BIF-1 regulates cytokinesis and degradative endocytic traffic.
20562859 2010 Network organization of the human autophagy system.
20159967 2010 GSK-3beta promotes cell survival by modulating Bif-1-dependent autophagy and cell death.
19805544 2009 Bax activates endophilin B1 oligomerization and lipid membrane vesiculation.
19132989 2008 Somatic mutation of pro-cell death Bif-1 gene is rare in common human cancers.
19125733 2009 Bif-1 and Bax expression in cutaneous Merkel cell carcinoma.
19074440 2009 Endophilin B1/Bif-1 stimulates BAX activation independently from its capacity to produce large scale membrane morphological rearrangements.
18833585 2008 Down-regulation of Bax-interacting factor-1 in colorectal adenocarcinoma.
18824435 2008 Bax-interacting factor-1 expression in prostate cancer.
18752120 2008 Decreased expression of Bax-interacting factor-1 (Bif-1) in invasive urinary bladder and gallbladder cancers.
18474606 2008 SRC directly phosphorylates Bif-1 and prevents its interaction with Bax and the initiation of anoikis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17891140 2007 Bif-1 interacts with Beclin 1 through UVRAG and regulates autophagy and tumorigenesis.
16916719 2006 Decreased expression of tumour suppressor Bax-interacting factor-1 (Bif-1), a Bax activator, in gastric carcinomas.
16763557 2006 Endophilin BAR domain drives membrane curvature by two newly identified structure-based mechanisms.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16227588 2005 Loss of Bif-1 suppresses Bax/Bak conformational change and mitochondrial apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15452144 2004 Endophilin B1 is required for the maintenance of mitochondrial morphology.
14704270 2004 Regulation of synaptojanin 1 by cyclin-dependent kinase 5 at synapses.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456676 2003 Characterization of Endophilin B1b, a brain-specific membrane-associated lysophosphatidic acid acyl transferase with properties distinct from endophilin A1.
11604418 2001 Generation of high curvature membranes mediated by direct endophilin bilayer interactions.
11259440 2001 Molecular cloning and characterization of Bif-1. A novel Src homology 3 domain-containing protein that associates with Bax.
11161816 2001 SH3GLB, a new endophilin-related protein family featuring an SH3 domain.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
10531379 1999 Interaction of the metalloprotease disintegrins MDC9 and MDC15 with two SH3 domain-containing proteins, endophilin I and SH3PX1.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.