Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.33
PubTator Score 9.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Becker muscular dystrophy 1.175 3.6e-05
Duchenne muscular dystrophy 1.302 1.8e-10
glioblastoma 1.200 7.4e-03
limb girdle muscular dystrophy 2A 1.067 1.2e-06
lung cancer -1.400 8.0e-04
malignant mesothelioma -1.200 2.3e-06
ovarian cancer -1.500 3.6e-06
pancreatic cancer 1.200 2.8e-02
primary pancreatic ductal adenocarcinoma 1.268 3.1e-02
Rheumatoid arthritis -1.100 3.9e-02

Gene RIF (2)

AA Sequence

MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQY      1 - 70
CGDYELFVEAVEQNTLQEFLKLA                                                    71 - 93
//

Text Mined References (20)

PMID Year Title