Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.42
PubTator Score 5.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.874 2.0e-02
Multiple myeloma 2.470 9.4e-05
malignant mesothelioma -5.400 1.1e-09
medulloblastoma, large-cell -1.200 2.7e-03
Duchenne muscular dystrophy 2.353 1.9e-08
limb girdle muscular dystrophy 2A 1.172 4.7e-03
autosomal dominant Emery-Dreifuss muscul... 1.672 9.8e-03
fascioscapulohumeral muscular dystrophy 1.083 4.2e-03
juvenile dermatomyositis 1.890 3.7e-10
tuberculosis 1.300 1.3e-08
non-small cell lung cancer -1.155 2.8e-18
lung cancer -3.600 1.1e-04
colon cancer -1.500 1.4e-04
Breast cancer 2.700 2.5e-02
ovarian cancer -2.500 1.2e-06
dermatomyositis 1.700 5.2e-03

Synonym

Accession O75368 Q3SYL1 Q5JT50 Q6FIE8 Q9H0N8
Symbols SH3BGR
HEL-S-115

Gene

PDB

1U6T   1WRY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16186799 mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation. This study provides the first example of a gene that is downregulated in v-Rel-expressing cells also playng a role in v-Rel transformation
16080146 h-SH3BGRL should present a novel class of the thioredoxin fold proteins

AA Sequence

MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMRENVPENSRPATGYPLPPQIF      1 - 70
NESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA                               71 - 114
//

Text Mined References (20)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20029029 2009 Regulation of epidermal growth factor receptor trafficking by lysine deacetylase HDAC6.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16729043 2005 Phosphotyrosine interactome of the ErbB-receptor kinase family.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16186799 2006 The suppression of SH3BGRL is important for v-Rel-mediated transformation.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
16080146 2005 Crystal structure of human SH3BGRL protein: the first structure of the human SH3BGR family representing a novel class of thioredoxin fold proteins.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
9642120 1998 Identification and characterization of a new human gene encoding a small protein with high homology to the proline-rich region of the SH3BGR gene.
8589991 1995 Cloning of OL1, a putative olfactory receptor and its expression in the developing rat heart.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.