Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.73
PubTator Score 4.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy -1.107 2.3e-05
astrocytic glioma -1.300 2.2e-02
Breast cancer 2.800 2.9e-02
colon cancer -3.100 1.4e-04
group 4 medulloblastoma -1.200 3.7e-03
lung cancer -1.100 5.7e-03
medulloblastoma, large-cell -1.900 9.0e-05
non diabetic and post-ischemic heart fai... -1.100 1.2e-02
oligodendroglioma -1.200 4.8e-02
psoriasis -1.100 3.6e-03
subependymal giant cell astrocytoma 1.646 4.5e-02

Gene RIF (3)

AA Sequence

MPLLLLGETEPLKLERDCRSPVDPWAAASPDLALACLCHCQDLSSGAFPDRGVLGGVLFPTVEMVIKVFV      1 - 70
ATSSGSIAIRKKQQEVVGFLEANKIDFKELDIAGDEDNRRWMRENVPGEKKPQNGIPLPPQIFNEEQYCG     71 - 140
DFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDVGNLPEAQEKNEEEGETATEETE    141 - 210
EIAMEGAEGEAEEEEETAEGEEPGEDEDS                                             211 - 239
//

Text Mined References (10)

PMID Year Title