Property Summary

NCBI Gene PubMed Count 19
PubMed Score 125.32
PubTator Score 176.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.725 2.3e-04
posterior fossa group B ependymoma -1.500 4.2e-11
cystic fibrosis -1.511 2.1e-05
non-small cell lung cancer -2.098 9.4e-23
interstitial cystitis 1.700 2.6e-05
adult high grade glioma -1.300 2.1e-06
pilocytic astrocytoma -1.100 4.7e-06
lung carcinoma -1.100 7.2e-13

Gene RIF (5)

PMID Text
22081014 The structure of the NSP3-p130Cas complex reveals that this closed conformation is instrumental for interaction of NSP proteins with a focal adhesion-targeting domain present in Cas proteins.
20583170 Observational study of gene-disease association. (HuGE Navigator)
17427198 NSP3 overexpression did not induce anti-estrogen resistance in breast tumor cell lines.
17270363 SH2D3C (SHEP1) is less highly expressed than BCAR3 and NSP1 in breast cancer cells, and the expression patterns suggest differential roles for the three genes during breast cancer progression.
12486027 This protein positively regulates T cell receptor-mediated interleukin-2 production by Jurkat cells.

AA Sequence

MTEGTKKTSKKFKFFKFKGFGSLSNLPRSFTLRRSSASISRQSHLEPDTFEATQDDMVTVPKSPPAYARS      1 - 70
SDMYSHMGTMPRPSIKKAQNSQAARQAQEAGPKPNLVPGGVPDPPGLEAAKEVMVKATGPLEDTPAMEPN     71 - 140
PSAVEVDPIRKPEVPTGDVEEERPPRDVHSERAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKL    141 - 210
SSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKINKVVVKAGESYTH    211 - 280
IQYLFEQESFDHVPALVRYHVGSRKAVSEQSGAIIYCPVNRTFPLRYLEASYGLGQGSSKPASPVSPSGP    281 - 350
KGSHMKRRSVTMTDGLTADKVTRSDGCPTSTSLPRPRDSIRSCALSMDQIPDLHSPMSPISESPSSPAYS    351 - 420
TVTRVHAAPAAPSATALPASPVARRSSEPQLCPGSAPKTHGESDKGPHTSPSHTLGKASPSPSLSSYSDP    421 - 490
DSGHYCQLQPPVRGSREWAATETSSQQARSYGERLKELSENGAPEGDWGKTFTVPIVEVTSSFNPATFQS    491 - 560
LLIPRDNRPLEVGLLRKVKELLAEVDARTLARHVTKVDCLVARILGVTKEMQTLMGVRWGMELLTLPHGR    561 - 630
QLRLDLLERFHTMSIMLAVDILGCTGSAEERAALLHKTIQLAAELRGTMGNMFSFAAVMGALDMAQISRL    631 - 700
EQTWVTLRQRHTEGAILYEKKLKPFLKSLNEGKEGPPLSNTTFPHVLPLITLLECDSAPPEGPEPWGSTE    701 - 770
HGVEVVLAHLEAARTVAHHGGLYHTNAEVKLQGFQARPELLEVFSTEFQMRLLWGSQGASSSQARRYEKF    771 - 840
DKVLTALSHKLEPAVRSSEL                                                      841 - 860
//

Text Mined References (21)

PMID Year Title
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
23568457 2013 Genetic variants associated with disordered eating.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22081014 2011 NSP-Cas protein structures reveal a promiscuous interaction module in cell signaling.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
17427198 2007 AND-34/BCAR3 differs from other NSP homologs in induction of anti-estrogen resistance, cyclin D1 promoter activation and altered breast cancer cell morphology.
17270363 2007 Splice variants and expression patterns of SHEP1, BCAR3 and NSP1, a gene family involved in integrin and receptor tyrosine kinase signaling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15272013 2004 SHEP1 function in cell migration is impaired by a single amino acid mutation that disrupts association with the scaffolding protein cas but not with Ras GTPases.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12486027 2003 A novel hematopoietic adaptor protein, Chat-H, positively regulates T cell receptor-mediated interleukin-2 production by Jurkat cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10692442 2000 Chat, a Cas/HEF1-associated adaptor protein that integrates multiple signaling pathways.
10542222 1999 A novel signaling intermediate, SHEP1, directly couples Eph receptors to R-Ras and Rap1A.
10187783 1999 NSP1 defines a novel family of adaptor proteins linking integrin and tyrosine kinase receptors to the c-Jun N-terminal kinase/stress-activated protein kinase signaling pathway.