Property Summary

NCBI Gene PubMed Count 9
PubMed Score 291.41
PubTator Score 204.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
colon cancer 1.200 9.7e-03
interstitial cystitis -1.100 1.2e-02
osteosarcoma -1.396 3.5e-06
ovarian cancer -1.200 3.9e-06
pancreatic cancer 1.100 1.4e-04
spina bifida -1.401 2.7e-02

Gene RIF (2)

AA Sequence

MQVPQDGEDLAGQPWYHGLLSRQKAEALLQQNGDFLVRASGSRGGNPVISCRWRGSALHFEVFRVALRPR      1 - 70
PGRPTALFQLEDEQFPSIPALVHSYMTGRRPLSQATGAVVSRPVTWQGPLRRSFSEDTLMDGPARIEPLR     71 - 140
ARKWSNSQPADLAHMGRSREDPAGMEASTMPISALPRTSSDPVLLKAPAPLGTVADSLRASDGQLQAKAP    141 - 210
TKPPRTPSFELPDASERPPTYCELVPRVPSVQGTSPSQSCPEPEAPWWEAEEDEEEENRCFTRPQAEISF    211 - 280
CPHDAPSCLLGPQNRPLEPQVLHTLRGLFLEHHPGSTALHLLLVDCQATGLLGVTRDQRGNMGVSSGLEL    281 - 350
LTLPHGHHLRLELLERHQTLALAGALAVLGCSGPLEERAAALRGLVELALALRPGAAGDLPGLAAVMGAL    351 - 420
LMPQVSRLEHTWRQLRRSHTEAALAFEQELKPLMRALDEGAGPCDPGEVALPHVAPMVRLLEGEEVAGPL    421 - 490
DESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPNPELREALTTGFVRRLLWGSRGAGAPRAERFEK    491 - 560
FQRVLGVLSQRLEPDR                                                          561 - 576
//

Text Mined References (15)

PMID Year Title