Property Summary

NCBI Gene PubMed Count 35
PubMed Score 41.62
PubTator Score 39.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 2.300 4.2e-04
medulloblastoma, large-cell 1.500 4.5e-05
tuberculosis and treatment for 6 months -1.900 4.3e-05
lung cancer -1.100 1.9e-03
interstitial cystitis 1.100 1.1e-03
ovarian cancer 1.100 2.0e-09
psoriasis 2.400 2.0e-110

Protein-protein Interaction (10)

Gene RIF (20)

PMID Text
26163016 TSAD binds to and co-localizes with Nck. Expression of TSAD increases both Nck-Lck and Nck-SLP-76 interaction in T cells.
25492967 The kinase Itk and the adaptor TSAd change the specificity of the kinase Lck in T cells by promoting the phosphorylation of Tyr192.
24910151 Data indicate the expression pattern of T cell-specific adapter protein (TSAd) in various healthy lymphoid and non-lymphoid tissues.
21696499 in chronic inflammatory demyelinating polyneuropathy we found an association with a homozygous genotype for a low repeat number of tandem GA in the SH2D2A gene
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20305788 TSAd, through its interaction with both Itk and Lck, primes Itk for Lck mediated phosphorylation and thereby regulates CXCL12 induced T cell migration and actin cytoskeleton rearrangements
19913121 Observational study of gene-disease association. (HuGE Navigator)
19561400 TSAd associates with laminin binding protein and mediates T lymphocyte migration during T cell activation
19240061 Observational study of gene-disease association. (HuGE Navigator)
18554728 the present study shows that the SH2D2A gene may contribute to susceptibility to MS.
18554728 Observational study of gene-disease association. (HuGE Navigator)
18541536 lymphocyte-specific protein tyrosine kinase binds to T cell-specific adapter protein (TSAd) prolines and phosphorylates and interacts with the three C-terminal TSAd tyrosines
18533279 This study found a significant association between CIDP and the genotype GA13-16 homozygote (OR 3.167; p 0.013).
18533279 Observational study of gene-disease association. (HuGE Navigator)
18160104 SH2D2A expression is regulated both at the transcriptional and translational level.
17327418 upon chemokine stimulation, Lad acts as an adaptor protein that links the G protein beta subunit to the tyrosine kinases Lck and Zap-70, thereby mediating T-cell migration
15752554 TSAd appears to contribute to interleukin-2 synthesis at multiple different levels
15129233 Observational study of gene-disease association. (HuGE Navigator)
15129233 'short' alleles of the promoter could contribute to the genetic susceptibility to Juvenile Rheumatoid Arthritis
11528519 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASNTGNAERAEEVPGEGSLFL      1 - 70
QAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVRFSESAVTFVLTYRSRTCCRH     71 - 140
FLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQ    141 - 210
DPNPQYSPIIKQGQAPVPMQKEGAGEKEPSQLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIY    211 - 280
NEPDEPIAFYAMGRGSPGEAPSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQ    281 - 350
GPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ                                   351 - 389
//

Text Mined References (36)

PMID Year Title
26163016 2015 T cell specific adaptor protein (TSAd) promotes interaction of Nck with Lck and SLP-76 in T cells.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25492967 2014 The kinase Itk and the adaptor TSAd change the specificity of the kinase Lck in T cells by promoting the phosphorylation of Tyr192.
25416956 2014 A proteome-scale map of the human interactome network.
24910151 2014 Expression of the T cell-specific adapter protein in human tissues.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
21696499 2011 Polymorphism of CD1 and SH2D2A genes in inflammatory neuropathies.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20305788 2010 T cell specific adapter protein (TSAd) interacts with Tec kinase ITK to promote CXCL12 induced migration of human and murine T cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19561400 2009 The adaptor protein LAD/TSAd mediates laminin-dependent T cell migration via association with the 67 kDa laminin binding protein.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18554728 2008 The SH2D2A gene and susceptibility to multiple sclerosis.
18541536 2008 Modulation of Lck function through multisite docking to T cell-specific adapter protein.
18533279 2008 Susceptibility to chronic inflammatory demyelinating polyradiculoneuropathy is associated to polymorphic GA repeat in the SH2D2A gene.
18160104 2008 Expression of SH2D2A in T-cells is regulated both at the transcriptional and translational level.
17327418 2007 The adaptor protein Lad associates with the G protein beta subunit and mediates chemokine-dependent T-cell migration.
16839418 2006 Structure function analysis of SH2D2A isoforms expressed in T cells reveals a crucial role for the proline rich region encoded by SH2D2A exon 7.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
15962004 2005 VEGF receptor-2 Y951 signaling and a role for the adapter molecule TSAd in tumor angiogenesis.
15827961 2005 The C terminus of T cell-specific adapter protein (TSAd) is necessary for TSAd-mediated inhibition of Lck activity.
15752554 2005 The emerging role of the T cell-specific adaptor (TSAd) protein as an autoimmune disease-regulator in mouse and man.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15129233 2004 Genetic association between juvenile rheumatoid arthritis and polymorphism in the SH2D2A gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11528519 2001 The T cell regulator gene SH2D2A contributes to the genetic susceptibility of multiple sclerosis.
10752626 2000 The SH2D2A gene encoding the T-cell-specific adapter protein (TSAd) is localized centromeric to the CD1 gene cluster on human Chromosome 1.
10692392 2000 VRAP is an adaptor protein that binds KDR, a receptor for vascular endothelial cell growth factor.
10587356 1999 RIBP, a novel Rlk/Txk- and itk-binding adaptor protein that regulates T cell activation.
10553045 1999 Lad, an adapter protein interacting with the SH2 domain of p56lck, is required for T cell activation.
9468509 1998 Molecular cloning of a T cell-specific adapter protein (TSAd) containing an Src homology (SH) 2 domain and putative SH3 and phosphotyrosine binding sites.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.