Property Summary

NCBI Gene PubMed Count 20
PubMed Score 48.26
PubTator Score 24.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic cancer -1.700 6.4e-03
rhinitis with controlled asthma 1.400 2.1e-03
uncontrolled asthma 1.900 4.0e-03
tuberculosis and treatment for 6 months -1.800 7.7e-04
lung adenocarcinoma -1.600 5.1e-16
pancreatic carcinoma -1.700 6.4e-03
lung carcinoma -1.200 2.8e-08

Gene RIF (3)

PMID Text
24687958 EAT-2 mediates its effects in natural killer cells by linking SLAM family receptors to phospholipase Cgamma, calcium fluxes, and Erk kinase.
24374770 Data indicate that Ewing's sarcoma-associated transcript-2 (EAT-2) over-expression increased the anti-tumor activity of NK cells against K562 tumor cell. targets.
16920955 NTB-A-mediated IFN-gamma production was greatly reduced in the absence of SLAM-associated protein (SAP), demonstrating that cytokine production and cytotoxicity are differentially dependent on SAP and possibly EAT-2

AA Sequence

MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEG      1 - 70
SPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP             71 - 132
//

Text Mined References (21)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24687958 2014 EAT-2, a SAP-like adaptor, controls NK cell activation through phospholipase C?, Ca++, and Erk, leading to granule polarization.
24642916 2014 Fine specificity and molecular competition in SLAM family receptor signalling.
24374770 2014 Manipulation of EAT-2 expression promotes induction of multiple beneficial regulatory and effector functions of the human innate immune system as a novel immunomodulatory strategy.
23322602 2013 Deciphering of ADP-induced, phosphotyrosine-dependent signaling networks in human platelets by Src-homology 2 region (SH2)-profiling.
21219180 2011 SLAM family receptors and SAP adaptors in immunity.
16920955 2006 Molecular analysis of NTB-A signaling: a role for EAT-2 in NTB-A-mediated activation of human NK cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16425036 2006 Identification and characterization of two related murine genes, Eat2a and Eat2b, encoding single SH2-domain adapters.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12928397 2003 Functional requirements for interactions between CD84 and Src homology 2 domain-containing proteins and their contribution to human T cell activation.
12787752 2003 The SLAM family of immune-cell receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12115647 2002 CD84 is up-regulated on a major population of human memory B cells and recruits the SH2 domain containing proteins SAP and EAT-2.
11689425 2001 Structural basis for the interaction of the free SH2 domain EAT-2 with SLAM receptors in hematopoietic cells.
11244050 2001 X-linked lymphoproliferative disease: a progressive immunodeficiency.
9000139 1996 EAT-2 is a novel SH2 domain containing protein that is up regulated by Ewing's sarcoma EWS/FLI1 fusion gene.