Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.40
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute myeloid leukemia 1.400 2.7e-03
adult high grade glioma -2.200 1.8e-04
astrocytic glioma -2.100 5.6e-03
Astrocytoma, Pilocytic -1.400 9.4e-04
atypical teratoid / rhabdoid tumor -3.100 1.8e-07
ependymoma -3.000 6.8e-03
glioblastoma -1.700 7.4e-07
group 3 medulloblastoma -1.700 2.1e-02
intraductal papillary-mucinous carcinoma... -1.400 5.7e-03
medulloblastoma, large-cell -3.200 1.2e-06
oligodendroglioma -1.800 2.4e-02
osteosarcoma -1.073 1.2e-03
ovarian cancer -1.700 1.7e-06
primary Sjogren syndrome 1.500 2.0e-04
primitive neuroectodermal tumor -1.900 1.8e-05
sarcoidosis 1.500 1.0e-02
ulcerative colitis 1.600 9.8e-05

 Compartment GO Term (1)

AA Sequence

MSSIKHLVYAVIRFLREQSQMDTYTSDEQESLEVAIQCLETVFKISPEDTHLAVSQPLTEMFTSSFCKND      1 - 70
VLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLGHYTDAIK     71 - 140
DCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTG    141 - 210
LSFDMASLINNPAFISMAASLMQNPQVQQLMSGMMTNAIGGPAAGVGGLTDLSSLIQAGQQFAQQIQQQN    211 - 280
PELIEQLRNHIRSRSFSSSAEEHS                                                  281 - 304
//

Text Mined References (15)

PMID Year Title